Serratia plymuthica 4Rx13: SOD_c17340 Help Entry SOD_c17340        CDS       T02710                                  Symbol acpP Name (GenBank) acyl carrier protein AcpP   KO K02078   acyl carrier protein Organism srl  Serratia plymuthica 4Rx13 Pathway srl00998   Biosynthesis of various antibiotics srl01100   Metabolic pathways srl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:srl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SOD_c17340 (acpP)    00074 Mycolic acid biosynthesis     SOD_c17340 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SOD_c17340 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 Motif Other DBs NCBI-ProteinID:  AGO54713 LinkDB All DBs Position 1898414..1898650 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIVEQLGVKQEEVLNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDFINASQQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaatcattgttgagcaactgggtgttaaacag gaagaagttttaaacaacgcttctttcgttgaagatctgggcgctgattctcttgacacc gttgaactggtaatggcactggaagaagaattcgataccgagattccagacgaagaagct gagaaaatcactactgttcaggcagctattgatttcatcaacgctagccagcagtaa

DBGET integrated database retrieval system