Salinibacter ruber M8: SRM_02543
Help
Entry
SRM_02543 CDS
T01209
Symbol
ilvE
Name
(GenBank) branched-chain amino acid aminotransferase
KO
K00826
branched-chain amino acid aminotransferase [EC:
2.6.1.42
]
Organism
srm
Salinibacter ruber M8
Pathway
srm00270
Cysteine and methionine metabolism
srm00280
Valine, leucine and isoleucine degradation
srm00290
Valine, leucine and isoleucine biosynthesis
srm00770
Pantothenate and CoA biosynthesis
srm01100
Metabolic pathways
srm01110
Biosynthesis of secondary metabolites
srm01210
2-Oxocarboxylic acid metabolism
srm01230
Biosynthesis of amino acids
srm01240
Biosynthesis of cofactors
Module
srm_M00019
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
srm_M00570
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:
srm00001
]
09100 Metabolism
09105 Amino acid metabolism
00270 Cysteine and methionine metabolism
SRM_02543 (ilvE)
00280 Valine, leucine and isoleucine degradation
SRM_02543 (ilvE)
00290 Valine, leucine and isoleucine biosynthesis
SRM_02543 (ilvE)
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
SRM_02543 (ilvE)
09180 Brite Hierarchies
09181 Protein families: metabolism
01007 Amino acid related enzymes [BR:
srm01007
]
SRM_02543 (ilvE)
Enzymes [BR:
srm01000
]
2. Transferases
2.6 Transferring nitrogenous groups
2.6.1 Transaminases
2.6.1.42 branched-chain-amino-acid transaminase
SRM_02543 (ilvE)
Amino acid related enzymes [BR:
srm01007
]
Aminotransferase (transaminase)
Class IV
SRM_02543 (ilvE)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Aminotran_4
Motif
Other DBs
NCBI-ProteinID:
CBH25464
UniProt:
D5HBQ9
LinkDB
All DBs
Position
complement(2965551..2967251)
Genome browser
AA seq
566 aa
AA seq
DB search
MGRRGGGRQQCLDRRDEGQRPGRRGHRRRRAAAGLRGRLPVRHRLRGDEAAGRRRVSGRR
LQRPPGGTAAPRGADCRRRGGLRGGVSHSGGRRAGRPAPAGTGGQPVRLLPHGAPLGGRL
HRPRPLPGDSVPRPAGARHAGRDLRLDDRDADSGSRGRAPGRGGPRLVPARHRALQNYGH
PLGHREGVRQDPLDHRPHGRDDTPACPPASRAGRPGPHRRPSAQPRGLNLCPRASFFSRF
VTLSPDLSPPHAAMEPDIWYNGEFIDHEDAEIHVLSHVIHYGSSVFEGIRCYDTDQGSAV
FRLEEHMQRLVDSAKVYRMDIPFDLDELVEAVVDTIERSGLRGCYIRPVVLRGEGPMGVN
PLDNPVETFIAVWEWGEYLGEEALEKGVDVEVASWNRMAPNTFPAMAKAGGNYLNASLVK
MNAIKNDKMEGIMLSTDGYVAEGSGENLFVVKNDMLYTAPTGLSILPGITRASIIALAEE
RGYEVEEKKIPREALYTADELFFTGTAAEVTPIRTVDDYTIGSGSRGPVTKEMQDAFFEV
VEKGHDPHDWLTFVDVPAADEPEMTA
NT seq
1701 nt
NT seq
+upstream
nt +downstream
nt
gtgggtcgacgaggtggtggtcgtcaacaatgcctcgaccgacgcgacgaaggccaacgc
ccgggccgccggggccaccgtcgtcgacgagccgcagcagggctacggggccgcctgcct
gtgcggcatcgcctacgcggagacgaggcagccggacgtcgtcgtgtttctggacggcga
ctacagcgaccacccggaggaactgccgcgcctcgtggagccgattgccgccgacgaggc
ggacttcgtggtggggtctcgcattcggggggacgccgagccgggcgccctgctcccgca
ggcacaggtgggcaaccggttcgcctgctccctcatggcgcgcctctggggggcagacta
caccgacctcggccccttccgggcgattcggttccgcgccctgcaggcgctcgacatgca
ggacgagaccttcggctggacgatcgagatgcagattcgggctctcgaggccgggctccg
ggtcgaggaggtccccgtctcgtaccggcgcggcatcgggccctccaaaattacgggcac
cctctcgggcaccgtgaaggcgtccgccaagatcctctggaccatcggccgcatggccgc
gacgacacaccggcgtgccccccggcttcgagagcgggtcgaccgggcccgcaccgacgc
cccagcgcccaacccagggggctgaacctttgccccagggcgtcgtttttctctcggttc
gtcacgctatcccccgacctttcgcccccgcacgccgccatggagcccgacatctggtac
aacggagaatttatcgaccacgaggacgctgagattcacgtcctctcccacgtcatccac
tacgggtcctccgtctttgaggggattcgctgttacgacaccgatcagggatcggccgtc
ttccggctggaggagcacatgcagcgcctggtcgactcggccaaggtgtaccggatggac
attcccttcgacctcgacgagctcgtcgaggccgtcgtggacaccatcgagcggagcggc
ctgcgcgggtgctacatccggcccgtcgtgcttcggggcgagggcccgatgggcgtcaac
ccgctcgacaacccggtggagaccttcatcgccgtctgggagtggggcgagtacctcggc
gaagaggccctggagaagggggtggacgtggaggtggccagctggaaccgcatggcgccc
aacacctttccggcgatggcgaaggcgggcgggaattacctgaacgcctccctcgtgaag
atgaacgccatcaagaacgacaagatggagggcatcatgctgagcacggacggctacgtg
gccgaggggagcggcgagaacctctttgtggtaaagaacgacatgctctacaccgcgccg
acggggctgtccatcctgcccggcattacgcgggcctccatcatcgcgctggccgaggag
cgcggctacgaggtagaagagaagaaaattccccgggaggcgctctacacggccgacgag
ctcttctttaccggcacggccgccgaggtcacgcccatccgcacggtcgatgactacacg
atcggctccggctcgcgcgggcccgtcacgaaggagatgcaggacgcgttcttcgaggtc
gtcgagaaggggcacgacccgcacgactggctgacgttcgtggacgtgccggcggcggac
gaaccggagatgacggcctag
DBGET
integrated database retrieval system