Streptosporangium roseum: Sros_1067 Help Entry Sros_1067         CDS       T01137                                  Name (GenBank) hypothetical protein   KO K03073   preprotein translocase subunit SecE Organism sro  Streptosporangium roseum Pathway sro02024   Quorum sensing sro03060   Protein export sro03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:sro00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     Sros_1067  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     Sros_1067  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     Sros_1067  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:sro02044]     Sros_1067 Secretion system [BR:sro02044]  Sec (secretion) system   Prokaryotic Sec-SRP core components    Sros_1067 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SecE PetM Motif Other DBs NCBI-ProteinID:  ACZ84067 UniProt:  D2B9R1 LinkDB All DBs Position 1090970..1091218 Genome browser AA seq 82 aa AA seqDB search MAIDTRGETADKPSGEKKAKRTSPALFYRQVVAELRKVIWPTRKDLISYTIIVLVFVLIM VGIVSGLDAVFTEGVLRIFGGA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt gtggcgatcgacacgcgcggcgaaaccgcagacaagccgagcggtgagaagaaggcgaag cgaacttctcccgccctcttctaccggcaggttgtcgctgagctgcgcaaggtcatctgg cctacgcgcaaggaccttatttcctacaccatcatcgtcctggtctttgttctgatcatg gtcgggatcgtgtctgggctcgacgcggtgttcaccgagggtgtgctgcggatcttcggc ggagcctga

DBGET integrated database retrieval system