KEGG   Streptosporangium roseum: Sros_3666
Entry
Sros_3666         CDS       T01137                                 
Name
(GenBank) Taurine dioxygenase
  KO
K03119  taurine dioxygenase [EC:1.14.11.17]
Organism
sro  Streptosporangium roseum
Pathway
sro00430  Taurine and hypotaurine metabolism
sro00920  Sulfur metabolism
Brite
KEGG Orthology (KO) [BR:sro00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Sros_3666
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Sros_3666
Enzymes [BR:sro01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.17  taurine dioxygenase
     Sros_3666
SSDB
Motif
Pfam: TauD
Other DBs
NCBI-ProteinID: ACZ86595
UniProt: D2AS68
LinkDB
Position
complement(4063973..4064887)
AA seq 304 aa
MNALILNEPGRAQIGPRTLRRLPEGWPRRPCARLRIRPAGPLIGAEITGVDLGAPLDEEL
KAELRDALLEWKVLFFRGRRVTGADQRRLAEVWGKVETFPFLSKGRSPDVVRFAKHEERP
GLENTWHSDATWHPTPSMGAVLRAVEVPAGGGGDTIWSDVAAAYDNLDPELAALVDGREA
VHHFDWLYSRLGLLEGEELDRARADFPPVRHPIVRTHPVTGRKGIFVNRVFTEGVVGLEH
GAARELIDRLCRHVETPEYQVRFRWEPGSVAVWDNRATQHYAVNDYYPERRVMERISIAG
DRPR
NT seq 915 nt   +upstreamnt  +downstreamnt
gtgaacgccctgatcctgaacgagccggggcgggcgcagatcggccccagaacgctgcgc
aggctgccggagggctggccgcgccggccctgcgcacggctgcggatccgcccggcgggc
cccctgatcggagccgagatcacgggggtggacctgggcgcgccgctcgacgaggagctc
aaggccgagctgagagacgcgctgctcgaatggaaggtcctcttcttccgcggccggcgc
gtgaccggtgcggaccagcgccggctggccgaggtctggggaaaggtggagaccttcccc
ttcctgtcgaagggcaggtcgccggatgtcgtccggttcgccaagcatgaggaacgtccg
ggcctggagaacacctggcactcggacgccacctggcatcccacccccagcatgggggcg
gtgctgcgggccgtcgaggtgccggcgggcggtggcggcgacaccatctggtccgacgtc
gccgcggcctacgacaacctcgaccccgaactggccgcgttggtcgacggccgcgaggcg
gtccaccacttcgactggctctactcccggctggggctcctcgaaggtgaggagctcgac
agggcgcgggccgacttcccgccggtgcgccatccgatcgtgcggacccatccggtgacc
gggcgcaagggcatcttcgtcaaccgggtgttcaccgagggcgtcgtgggactggagcac
ggcgcggccagggagctcatcgaccggctgtgccggcatgtggagacgccggagtatcag
gtgaggttccgctgggagcccggctccgtcgccgtctgggacaaccgcgccacccagcac
tacgcggtcaacgactactacccggagcggcgggtcatggagcgcatctccatcgccggc
gaccgcccgcgctag

DBGET integrated database retrieval system