Streptosporangium roseum: Sros_7006 Help Entry Sros_7006         CDS       T01137                                  Name (GenBank) hypothetical protein   KO K27095   acyl-CoA carboxylase epsilon subunit Organism sro  Streptosporangium roseum Pathway sro00074   Mycolic acid biosynthesis sro00280   Valine, leucine and isoleucine degradation sro00630   Glyoxylate and dicarboxylate metabolism sro00640   Propanoate metabolism sro01100   Metabolic pathways sro01110   Biosynthesis of secondary metabolites sro01120   Microbial metabolism in diverse environments sro01200   Carbon metabolism Module sro_M00741   Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA Brite KEGG Orthology (KO) [BR:sro00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     Sros_7006    00640 Propanoate metabolism     Sros_7006   09103 Lipid metabolism    00074 Mycolic acid biosynthesis     Sros_7006   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     Sros_7006 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACC_epsilon Motif Other DBs NCBI-ProteinID:  ACZ89706 UniProt:  D2B8V0 LinkDB All DBs Position complement(7730194..7730430) Genome browser AA seq 78 aa AA seqDB search MGEGPLLRVVRGNPTPEELAALIAVVLARASSAAAAEAVPSAWADRSRSMRQPPVPGRRA VSDDSRIPAPWRRLKFSP NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgggcgaggggccgctcctgcgggtggtgcgcgggaatccgacacctgaggaactggcg gcgctcatcgccgtcgtgctcgcgcgcgcgtcctcggccgccgctgcggaggcggtgccg tccgcctgggccgaccgctcgcggtccatgcggcagccgcccgtgccgggccgccgggcg gtcagtgacgactctcggattccggccccctggcgacgcctgaaattctccccctga

DBGET integrated database retrieval system