Streptomyces roseicoloratus: RGF97_06525 Help Entry RGF97_06525       CDS       T09671                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism sroc  Streptomyces roseicoloratus Pathway sroc00253   Tetracycline biosynthesis sroc01056   Biosynthesis of type II polyketide backbone sroc01100   Metabolic pathways sroc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sroc00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     RGF97_06525    00253 Tetracycline biosynthesis     RGF97_06525  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:sroc01004]     RGF97_06525    01008 Polyketide biosynthesis proteins [BR:sroc01008]     RGF97_06525 Lipid biosynthesis proteins [BR:sroc01004]  Polyketide synthase   Component type    RGF97_06525 Polyketide biosynthesis proteins [BR:sroc01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      RGF97_06525     Nonaketide PKS      RGF97_06525     Decaketide PKS      RGF97_06525 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  WMX44583 LinkDB All DBs Position complement(1452230..1452499) Genome browser AA seq 89 aa AA seqDB search MTDMNLSELGALLLECVGAPEEGMSLEGEEALDTPFLEFGYDSLALLQATSVINRTYGIV LDDDAVMEAETPRMLLALIATAPRAGAIR NT seq 270 nt NT seq  +upstreamnt  +downstreamnt gtgactgacatgaacctgtccgagctgggggcgctcctgctcgagtgcgtcggcgcgccc gaggagggcatgtcgctggagggcgaggaggccctcgacaccccgttcctggagttcggc tacgactccctcgccctcctccaggccaccagcgtgatcaaccgcacctacggcatcgtc ctcgacgacgacgccgtcatggaggccgagaccccccggatgctgctcgcgctgatcgcc acggcgccgcgggccggcgcgatccgctga

DBGET integrated database retrieval system