Skermanella rosea: JL101_001430 Help Entry JL101_001430      CDS       T07666                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism sroe  Skermanella rosea Brite KEGG Orthology (KO) [BR:sroe00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:sroe03110]     JL101_001430 (grxC) Chaperones and folding catalysts [BR:sroe03110]  Protein folding catalysts   Protein disulfide isomerase    JL101_001430 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like Thioredoxin_2 GST_N Thioredoxin_3 SH3BGR CLIC-like_N Thioredoxin_4 AhpC-TSA Redoxin Motif Other DBs NCBI-ProteinID:  UEM04131 LinkDB All DBs Position 301654..301914 Genome browser AA seq 86 aa AA seqDB search MAEVVIYTSPWCPYCTRAKKLLAEKGVQFEEIDVMMQPRKRVEMTQLAEGRTSVPQIFID SKPIGGCDDLYALDRAGKLDPMLGRA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atggccgaagtcgtcatttataccagtccctggtgcccgtactgcacgcgggccaagaag ctgctggccgagaagggcgtccagttcgaggagatcgacgtgatgatgcagccgcgcaag cgggtggagatgacgcaactggccgaaggacggacctcggttccgcagatcttcatcgac tcgaagccgatcgggggctgcgacgacctctacgcgctcgaccgggccggcaagctcgac cccatgctgggccgcgcctga

DBGET integrated database retrieval system