KEGG   Skermanella rosea: JL101_001920
Entry
JL101_001920      CDS       T07666                                 
Name
(GenBank) response regulator
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
sroe  Skermanella rosea
Pathway
sroe02020  Two-component system
sroe02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:sroe00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    JL101_001920
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    JL101_001920
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:sroe02022]
    JL101_001920
   02035 Bacterial motility proteins [BR:sroe02035]
    JL101_001920
Two-component system [BR:sroe02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   JL101_001920
Bacterial motility proteins [BR:sroe02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    JL101_001920
SSDB
Motif
Pfam: Response_reg
Other DBs
NCBI-ProteinID: UEM04225
LinkDB
Position
406162..406527
AA seq 121 aa
MKSCLVVDDSRVVRKVARKILEELHFTCSEAEDGRQAMEACAREMPNAILLDWNMPVMTG
IEFLRRLRKMSGGDAPKVVFCTTENDLAHIQEALSAGANEYIMKPFDSDIIQTKFAQVGL
I
NT seq 366 nt   +upstreamnt  +downstreamnt
atgaaatcctgtcttgtcgtcgatgacagccgcgttgtccgcaaggtggcccggaagatc
ctggaggaactgcatttcacctgctcggaggccgaggacgggcgccaggcgatggaagcc
tgcgccagggagatgccgaacgcgatcctgctggactggaacatgccggtcatgaccggc
atcgagttcctgcggcggctgcgcaagatgtcgggcggcgacgccccgaaggtggtgttc
tgcacgaccgagaacgacctggcccacatccaggaggcgctgagcgccggtgccaacgag
tacatcatgaagcccttcgacagcgacatcatccagaccaagttcgcccaggtcggcctg
atctga

DBGET integrated database retrieval system