Skermanella rosea: JL101_007410 Help Entry JL101_007410      CDS       T07666                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sroe  Skermanella rosea Pathway sroe01100   Metabolic pathways sroe01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sroe00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JL101_007410    00074 Mycolic acid biosynthesis     JL101_007410   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JL101_007410 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N TRI4_N Motif Other DBs NCBI-ProteinID:  UEM05256 LinkDB All DBs Position 1595160..1595399 Genome browser AA seq 79 aa AA seqDB search MSDIADRVKKIVIEHLGVEESKVTENASFIDDLGADSLDTVELVMAFEEEFGCEIPDDAA EKILTVKDAIDFIKANAAA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagtgacatcgccgatcgcgtgaagaagatcgtcatcgaacacttgggcgtcgaagag tccaaggtcaccgagaatgccagcttcatcgacgatctgggcgccgacagcctggacacg gtcgagctggtcatggcgttcgaagaggagttcgggtgcgagatccccgacgacgccgcc gaaaagatcctgaccgtcaaggacgcgatcgatttcatcaaggcgaacgccgcggcctga

DBGET integrated database retrieval system