Streptomyces roseirectus: IAG44_01150 Help Entry IAG44_01150       CDS       T07860                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sroi  Streptomyces roseirectus Pathway sroi00998   Biosynthesis of various antibiotics sroi01100   Metabolic pathways sroi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sroi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     IAG44_01150    00074 Mycolic acid biosynthesis     IAG44_01150   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     IAG44_01150 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QNP68208 UniProt:  A0A7H0I5Z2 LinkDB All DBs Position 316023..316298 Genome browser AA seq 91 aa AA seqDB search MDRAGLIRELHEIAAGMTKGEHRPAPQEGDASLVDQYGFSSLDALEYLLILEEKFDVVFE DEDLTEETLFSIEGLASYILQQKAGESPSLT NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atggaccgcgccgggctgattcgcgaactccacgagatagcggcgggcatgaccaagggc gagcaccggccggccccccaggagggcgacgccagtctcgtggaccagtacgggttcagc tccctcgacgccctggagtacctgctgatcctcgaggagaagttcgatgtcgtcttcgag gacgaggacctgacggaggagacgctgttctccatcgagggccttgcgagctacatcctc cagcagaaggccggcgaaagcccctccctgacgtga

DBGET integrated database retrieval system