Streptomyces roseirectus: IAG44_09650 Help Entry IAG44_09650       CDS       T07860                                  Name (GenBank) acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism sroi  Streptomyces roseirectus Pathway sroi00253   Tetracycline biosynthesis sroi01056   Biosynthesis of type II polyketide backbone sroi01100   Metabolic pathways sroi01110   Biosynthesis of secondary metabolites Module sroi_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite KEGG Orthology (KO) [BR:sroi00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     IAG44_09650    00253 Tetracycline biosynthesis     IAG44_09650  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:sroi01004]     IAG44_09650    01008 Polyketide biosynthesis proteins [BR:sroi01008]     IAG44_09650 Lipid biosynthesis proteins [BR:sroi01004]  Polyketide synthase   Component type    IAG44_09650 Polyketide biosynthesis proteins [BR:sroi01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      IAG44_09650     Nonaketide PKS      IAG44_09650     Decaketide PKS      IAG44_09650 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C Motif Other DBs NCBI-ProteinID:  QNP69679 UniProt:  A0A7H0IA63 LinkDB All DBs Position complement(2370511..2370780) Genome browser AA seq 89 aa AA seqDB search MSEITLAELSELLLECVGAPEEGTSLDSDDALDTPFLDFGYDSLALLQVTGLITRRHGIV LSDDAVMEAETPRLLLNMIKDAPGAGAVR NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgagcgagatcaccctggccgagctgagcgaactgctgctggagtgcgtgggcgccccc gaggagggcacgagcctcgacagcgacgacgccctcgacacgccgttcctggacttcggc tacgactcgctggccctgctccaggtgaccggtctgatcacgcgccggcacggcatcgtg ctgtccgacgacgccgtgatggaggccgagaccccgcggctgctgctgaacatgatcaag gacgcgccgggcgccggagcggtccggtga

DBGET integrated database retrieval system