Spiribacter roseus: BBH56_01885 Help Entry BBH56_01885       CDS       T06143                                  Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism sros  Spiribacter roseus Pathway sros02024   Quorum sensing sros03018   RNA degradation Brite KEGG Orthology (KO) [BR:sros00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     BBH56_01885  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     BBH56_01885  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:sros03019]     BBH56_01885    03036 Chromosome and associated proteins [BR:sros03036]     BBH56_01885 Messenger RNA biogenesis [BR:sros03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      BBH56_01885 Chromosome and associated proteins [BR:sros03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     BBH56_01885 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Motif Other DBs NCBI-ProteinID:  AUB77986 UniProt:  A0ABV3S0P3 LinkDB All DBs Position 375684..375935 Genome browser AA seq 83 aa AA seqDB search MSKGQSLQEPFLNALRKEKVPVSIYLVNGIKLQGQVDSFDQFVILLRNSISQLVYKHAIS TIVPSRNVRELLQEERDPETDPE NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgtcgaaaggacaatcactgcaggaacccttcctcaacgcgcttcgcaaggaaaaggtc ccggtgtcgatctatctggtcaatggcatcaagctccagggtcaggtggactcgttcgac cagttcgtgatcctgcttcgcaactcgatcagtcagctggtctacaaacacgccatttcc acgatcgtgccatcgcgcaacgtccgcgagcttctgcaggaggagcgagatcccgaaacc gacccggagtga

DBGET integrated database retrieval system