KEGG   Spiribacter roseus: BBH56_04800
Entry
BBH56_04800       CDS       T06143                                 
Name
(GenBank) ABC transporter
  KO
K06147  ATP-binding cassette, subfamily B, bacterial
Organism
sros  Spiribacter roseus
Brite
KEGG Orthology (KO) [BR:sros00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sros02000]
    BBH56_04800
Transporters [BR:sros02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    BBH56_04800
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_21 AAA_16 AAA_29 AAA_22 RsgA_GTPase AAA_25 Zeta_toxin MMR_HSR1 AAA_33 ABC_ATPase nSTAND1 Guanylate_kin SbcC_Walker_B
Other DBs
NCBI-ProteinID: AUB78477
LinkDB
Position
complement(967177..968922)
AA seq 581 aa
MRRFGGLLRLSGYLRPYWRQALVAGTALIVAAASVLAIGQGLRLVIDQGFANGTGAALDR
ALMITAGVVLVLAVASAMRFYWVMWIGERVAADLRRDVFERLLDLDPGFYLRNGVGEIQS
RMTTDTALLQSVLGSTFSMALRNALLLIGTLIMLVVTQPTLSAMVIIGIPVVVAPMLIYG
RRVRRLSRLSQDRIAEVGSYAGETLGGIETVQAFVHEAEDRRVFRDRVEDAFSIAIQRIR
QRAGLNAVALLLAFAGVAFVLWRGGNAVIAGTMSAGELSAFVFYAVLAAGAVGVLSEVAG
ELFRASGAAERLFELLDAVPAIRPPADPVALPVPGRGEVVIEAVEYRYPTRPDPPALAGV
NLEIRAGETVALVGPSGAGKSTLISLLLRFHDPSAGRVRLDGVDLRDADPAALRRRMALV
AQEPVLFTGTIAGNIRFGDPAAAREKIVEAGRAANCEGFVEALPDGYDTHIGPGGVQLSG
GQRQRIAIARAILRDPALLLLDEATSSLDAESERQVQTALTRLMAKRTSVVIAHRLATVR
NADRIAVLEAGQVRAVGTHDQLLAGDGLYAHLAALQFQSIA
NT seq 1746 nt   +upstreamnt  +downstreamnt
atgaggcgctttggtggactgctgcggttgtccgggtatctgcgcccgtactggcgccag
gccctggtggccggcacagcgctgatcgtggccgccgcgagtgtactggccatcggccag
ggcctgcgactggtgattgaccaggggtttgccaatggcacgggcgctgcccttgatcgc
gccctgatgatcaccgccggcgtggtgctggtgctggcggtggcgtcggccatgcgcttt
tactgggtgatgtggattggcgagcgggtcgcggcggatctgcgccgggacgtcttcgag
cgcctgctggatcttgaccccggtttctatctgcgtaacggcgtcggcgaaatccagtcg
cgcatgaccaccgacaccgcgctgttgcagagcgtactcggctcaacgttttccatggca
ctgcgcaatgcgctgctgctgatcggcacgctgatcatgctggtggtcacccagcccacg
ctgagtgccatggtcatcatcgggatcccggtggtggtggcgccgatgctcatctatggc
aggcgcgtgcgccgcctctcgcgcctcagccaggaccggatcgccgaggtggggagctac
gccggcgagacgctgggtggcatcgagacggttcaggccttcgtccatgaggccgaagac
cgacgggtctttcgtgaccgggtggaggatgcctttagcattgcgatccagcgcatccgc
cagcgcgccgggttgaacgcagtggcgctgctgttggcgtttgcgggcgtcgcttttgtg
ctgtggcgcggcggcaatgccgtgatcgccggcacgatgagcgccggcgagctctccgca
ttcgttttctacgcggtgctggccgcgggggccgtcggggtgctctcggaggtggcgggc
gagcttttccgggcctccggcgccgcggaacggctgtttgaactgcttgacgcggtgccc
gccatccgaccgccggccgatccggtggcattgccggtgcccggccggggtgaggtggtc
atcgaggcggtggagtaccgctatcccacacggcccgacccgccggcgcttgccggcgtc
aaccttgagatccgcgcgggggagaccgtggcactggtcgggccttcgggggcgggtaag
agcacgctgatcagccttctgctgcgttttcacgatccctccgcgggacgcgtgcgactc
gatggcgtggatctgcgcgacgccgatccggcggcgctacgccggcgtatggcgctggtg
gcgcaggagccggtgctgttcaccggcacgattgccgggaatatccgcttcggcgatccc
gccgcggcgcgcgagaaaatcgtcgaggcgggcagggcggcgaactgcgagggctttgtc
gaggcgcttcctgacggttacgacacgcacattggacccggcggcgtgcagctctcgggc
gggcagcgacagcgcatcgccattgcccgggccatcctccgcgatccggcgttgctgctg
ctcgatgaggccaccagcagcctcgacgccgagagcgagcgccaggtgcagaccgcgctc
acgcgcctgatggccaagcgcaccagcgtggtcatcgcccatcggctggcgaccgtgcgt
aacgccgatcgcattgcggtgctcgaggcggggcaggtgcgcgcggtgggcacccacgat
cagttgcttgcgggcgacggcctttacgcgcatctggcggcgttgcagtttcagtccatc
gcctga

DBGET integrated database retrieval system