Streptococcus suis ST1 (serotype 1): SSUST1_1860 Help Entry SSUST1_1860       CDS       T02125                                  Name (GenBank) preprotein translocase subunit   KO K03210   preprotein translocase subunit YajC Organism srp  Streptococcus suis ST1 (serotype 1) Pathway srp02024   Quorum sensing srp03060   Protein export srp03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:srp00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     SSUST1_1860  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     SSUST1_1860  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     SSUST1_1860  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:srp02044]     SSUST1_1860 Secretion system [BR:srp02044]  Sec (secretion) system   Prokaryotic Sec-SRP core components    SSUST1_1860 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YajC RuvA_N CASTOR1_ACT-like DUF3188 Sema4F_C DUF4381 Ly49 DUF4079 Motif Other DBs NCBI-ProteinID:  AER22207 LinkDB All DBs Position complement(1807761..1808084) Genome browser AA seq 107 aa AA seqDB search MEGLFLPLVMVAMIGFMFYSQRKQQKQRQEALNQIKKGDEIVTIGGLFGIVDEIDDKKVV LDVDGVYLTFERGAIRNRVASSDTTSAVVEEVAVETTEATSESAIEE NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggaaggtttatttttgccgcttgtcatggttgccatgattggttttatgttctattcg caacgtaaacaacaaaaacaacgtcaagaagcactaaatcaaatcaaaaaaggtgatgaa attgtgaccattggtgggctatttggtattgtcgatgaaattgatgataagaaggttgtt ctcgatgttgatggtgtttacttgacatttgaacgtggtgctattcgtaatcgtgtagca agttcagatactacatctgcagttgttgaagaagtggcagttgaaacgacagaagcgact tcagaatctgcaattgaagaataa

DBGET integrated database retrieval system