Streptomyces sp. RPA4-5: HEP86_13440 Help Entry HEP86_13440       CDS       T10325                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism srpa  Streptomyces sp. RPA4-5 Pathway srpa00998   Biosynthesis of various antibiotics srpa01100   Metabolic pathways srpa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:srpa00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HEP86_13440    00074 Mycolic acid biosynthesis     HEP86_13440   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HEP86_13440 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QIY55360 LinkDB All DBs Position 2970204..2970452 Genome browser AA seq 82 aa AA seqDB search MAATQEEIVAGLAEIVNEIAGIPTEDVQVDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DDDVKNLKTVGDATEYILKHQS NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccactcaggaagagatcgtcgccggtctcgccgagatcgtgaacgagatcgcc gggatccccaccgaggacgtccaggtggacaagtccttcaccgacgacctggacgttgac tcgctgtccatggtcgaggtcgtcgtcgccgccgaagagcgcttcgacgtgaagatcccg gacgacgacgtcaagaacctcaagacggtcggcgacgcgaccgagtacatcctcaagcac cagagctga

DBGET integrated database retrieval system