Streptomyces sp. RPA4-5: HEP86_27605 Help Entry HEP86_27605       CDS       T10325                                  Symbol atpE Name (GenBank) ATP synthase F0 subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism srpa  Streptomyces sp. RPA4-5 Pathway srpa00190   Oxidative phosphorylation srpa01100   Metabolic pathways Module srpa_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:srpa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     HEP86_27605 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:srpa00194]     HEP86_27605 (atpE) Photosynthesis proteins [BR:srpa00194]  Photosystem and electron transport system   F-type ATPase [OT]    HEP86_27605 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C DUF441 Motif Other DBs NCBI-ProteinID:  QIY57593 UniProt:  A0A6H1K081 LinkDB All DBs Position 6149289..6149549 Genome browser AA seq 86 aa AA seqDB search MSAALEMVNLAAGSARTNVVGNVASIGYGLAAIGPGVGVGIIFGNGTQALARQPEAAGLI RTNQIMGFAFCEALALIGIVMGFVYQ NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgtccgctgctctcgaaatggtcaacctcgccgccggctccgccaggaccaacgtcgtc ggcaacgtcgcctccatcggttacggcctggccgcgatcggccccggcgtcggcgtcggc atcatcttcggtaacggcacccaggccctggcccgtcagcccgaggcggccggcctgatc cgcaccaaccagatcatgggtttcgccttctgtgaggcgctcgccctgatcggcatcgtc atgggcttcgtttaccagtaa

DBGET integrated database retrieval system