Streptomyces sp. RPA4-5: HEP86_36690 Help Entry HEP86_36690       CDS       T10325                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism srpa  Streptomyces sp. RPA4-5 Pathway srpa00261   Monobactam biosynthesis srpa01100   Metabolic pathways srpa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:srpa00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     HEP86_36690  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:srpa01008]     HEP86_36690 Polyketide biosynthesis proteins [BR:srpa01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     HEP86_36690 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QIY59006 UniProt:  A0A6H1JW65 LinkDB All DBs Position 8288070..8288294 Genome browser AA seq 74 aa AA seqDB search MASPFDDEEGIFLVVVNDENQHSLWPNWREVPAGWRTAFGPHSRQACLSYIERNWTDLRP ASLVPTQSTALRTV NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggcgagtccgtttgacgacgaagagggaatcttccttgtcgtggtgaatgacgagaac cagcactcgctgtggccgaactggcgtgaggttccagccggttggcgaaccgccttcggc ccgcacagcaggcaggcctgcctgtcctacatcgagcggaactggacggaccttcgcccc gccagcctggtgccgacccagtcgacggccctgcgcactgtctga

DBGET integrated database retrieval system