Streptomyces sp. RPA4-2: HEP85_03140 Help Entry HEP85_03140       CDS       T10422                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism srpz  Streptomyces sp. RPA4-2 Pathway srpz00998   Biosynthesis of various antibiotics srpz01100   Metabolic pathways srpz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:srpz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HEP85_03140    00074 Mycolic acid biosynthesis     HEP85_03140   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HEP85_03140 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QIY60872 LinkDB All DBs Position complement(776179..776427) Genome browser AA seq 82 aa AA seqDB search MSPVRTAVTTVLTEKFEVSPESIRPEATLESLDLDSLALAELALALQEQLGVPVEEDEAA KHSTVGELVAALNAKRAQWGTS NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgtcccccgtccggaccgccgtcaccaccgtactgaccgagaagttcgaggtcagtccc gagagcatccgccccgaggccaccctggagagcctcgacctcgactcgctcgcgctcgcc gaactcgccctggcgctccaggagcaactgggcgtccccgtggaggaggacgaggcggcc aagcacagcactgtcggtgaacttgtcgccgcgctgaacgccaagcgagcccagtggggc acctcgtga

DBGET integrated database retrieval system