Streptomyces sp. RPA4-2: HEP85_16300 Help Entry HEP85_16300       CDS       T10422                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism srpz  Streptomyces sp. RPA4-2 Brite KEGG Orthology (KO) [BR:srpz00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:srpz03032]     HEP85_16300    03036 Chromosome and associated proteins [BR:srpz03036]     HEP85_16300    03400 DNA repair and recombination proteins [BR:srpz03400]     HEP85_16300 DNA replication proteins [BR:srpz03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     HEP85_16300 Chromosome and associated proteins [BR:srpz03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     HEP85_16300 DNA repair and recombination proteins [BR:srpz03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       HEP85_16300 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding Urease_beta HU-HIG Motif Other DBs NCBI-ProteinID:  QIY62915 UniProt:  A0A6H1KLX0 LinkDB All DBs Position complement(3705639..3705920) Genome browser AA seq 93 aa AA seqDB search MNRSELVAALADRAEVTRKDADAVLAAFAETVGEIVSKGDEKVTIPGFLTFERTHRAART ARNPQTGDPIQIPAGYSVKVSAGSKLKEAAKGK NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaccgcagtgagctggtggccgcgctggccgaccgcgccgaggtgacccgcaaggac gccgacgccgttctggccgcgttcgccgagaccgtcggcgagatcgtctccaagggcgac gagaaggtcaccatccccggcttcctgaccttcgagcgcacccaccgtgccgctcgcacc gcgcgcaacccgcagaccggcgacccgatccagatcccggccggctacagcgtgaaggtc tccgcgggcagcaagctcaaggaagcggccaagggcaagtag

DBGET integrated database retrieval system