KEGG   Serratia plymuthica AS9: SerAS9_0440
Entry
SerAS9_0440       CDS       T01503                                 
Name
(GenBank) luciferase family oxidoreductase, group 1
Organism
srr  Serratia plymuthica AS9
SSDB
Motif
Pfam: Bac_luciferase
Other DBs
NCBI-ProteinID: AEF43596
LinkDB
Position
complement(490199..491212)
AA seq 337 aa
MTEKTVVPLSVLDLSPIPQGAKPRDAFHASLDLAQHAEKWGYQRYWLAEHHNMTGIGSAA
TSVLLGFLAAGTQSIRLGSGGVMLPNHAPLVIAEQFGTLESLYPGRIDLGLGRAPGTDQR
TMMALRRHLSGEVDNFPRDVQELQHYFCDAQPGQPVQAVPGQGLHVPIWLLGSSLYSAQL
AAQLGLPFAFASHFAPEMLFQALKLYRNNFKPSEQCAQPHAMVCVNVVAADSDEEARRLF
TSMQQQFINLRRGSPGPLPPPVDNIHALWSAGEQYGVDQALRMSIVGNESTVRHGLQALQ
RETGADEIMVNGQIFDHQARLHSFEIVAGVKGDVVKG
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgactgaaaaaaccgtggtaccgctttcggtactggatttatcccccattccgcaaggg
gccaaaccgcgcgatgcgtttcacgcctctttagatttagcacagcatgccgaaaagtgg
ggctatcagcgctattggttggcggaacatcacaatatgaccgggatcggcagtgcggcc
acctcggtgttgttgggctttctggccgccggcacccagagtatccgcctaggttccggc
ggtgtgatgctccctaaccatgcgccgctggtgatcgccgagcagtttggcacgctggaa
tcgttgtatccggggcgtatcgatctggggcttggccgcgcgcccggcaccgatcagcgc
accatgatggcgctgcggcgccacctgtccggcgaagtggataacttcccgcgtgacgtg
caggaactgcagcattatttctgcgatgcgcaaccgggccaaccggtgcaggcagtgccg
ggccagggcttgcatgtaccgatctggctgctgggttcgagcctgtacagcgcacagctg
gcggcacagcttggcctgccgttcgccttcgcctcccactttgcgccggaaatgttgttc
caggcgctgaagctgtatcgcaataacttcaaaccttccgagcaatgcgcacagccgcat
gccatggtatgcgtcaacgtggtggccgccgacagcgacgaagaggcccgccggctgttc
acctcgatgcaacagcaattcattaacctgcgccgcggttcgccgggcccgctgccgccg
ccggtggacaatatccacgcgctgtggagcgccggggagcaatacggtgtcgatcaggcg
ctgcgcatgtctatagtcggtaatgaaagcaccgttcgccacgggctgcaggcgctgcag
cgtgaaaccggcgcggatgaaatcatggtcaacggccagatctttgaccatcaggcgcgg
ctgcattcgtttgagattgtcgccggagtgaaaggcgatgtggtgaaaggctaa

DBGET integrated database retrieval system