Serratia plymuthica AS9: SerAS9_0814 Help Entry SerAS9_0814       CDS       T01503                                  Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism srr  Serratia plymuthica AS9 Pathway srr01100   Metabolic pathways srr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:srr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SerAS9_0814    00074 Mycolic acid biosynthesis     SerAS9_0814   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SerAS9_0814 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AEF43966 LinkDB All DBs Position 915507..915767 Genome browser AA seq 86 aa AA seqDB search MNLLSTEIKQLIIDTLNLEGMTPEEIDAEAPLFGEGLGLDSIDALELGLALKNRYGVVLS AESEDMRQHFYSVETLVKFVSALRSK NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgaatttattgagcaccgaaatcaagcaattgatcattgatacgctcaatcttgaaggt atgacgccggaggagattgatgccgaagcaccgctgtttggcgagggactgggcctggat tcgattgatgcgttggaattgggcctggcattaaagaaccgttatggcgtggtgctgtca gctgaaagcgaagacatgcgccaacatttttattccgtggaaacgctggtgaagtttgtt tctgcactgcgtagcaaataa

DBGET integrated database retrieval system