KEGG   Serratia plymuthica AS9: SerAS9_1741
Entry
SerAS9_1741       CDS       T01503                                 
Name
(GenBank) hypothetical protein
  KO
K21785  4-hydroxy-2,2'-bipyrrole-5-methanol dehydrogenase
Organism
srr  Serratia plymuthica AS9
Pathway
srr00333  Prodigiosin biosynthesis
srr01100  Metabolic pathways
srr01110  Biosynthesis of secondary metabolites
Module
srr_M00837  Prodigiosin biosynthesis, L-proline => prodigiosin
Brite
KEGG Orthology (KO) [BR:srr00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    SerAS9_1741
SSDB
Motif
Pfam: Nitroreductase
Other DBs
NCBI-ProteinID: AEF44871
LinkDB
Position
complement(1889309..1890211)
AA seq 300 aa
MLMSCGLFFEYVSTLLKHAGYPLNWRWEGTHRDDPVGGLISFTPAMPITADINAYSQLAK
AITERRTVRAPYQPTQVNPIQQACLQTLFDGSPVTLHFYQGEPVRHAVAHLTTRYASLDF
SHHQAWQETYQFIRFNERQYTEDGFYLHNLFGPVSNLFKCVFRIAFHPKLTPLATRLQLP
AMMAKGLAKQVGEGPQYLAMSLQDESDEHLFIAGMTLGQLWLTLHSWGWGLHPISVLVQH
ASARHALSDTLALVNPAVFFARFGHLQQSGAATPRRSWQSILTVSHQHSAAETKADVSKF
NT seq 903 nt   +upstreamnt  +downstreamnt
atgctgatgagctgtggccttttcttcgagtatgtcagcactctgctaaaacacgccggt
tacccgcttaactggcggtgggaaggtacgcatcgggatgatcctgttgggggattgatc
tcctttacaccggcgatgcctatcaccgccgatatcaatgcttactcacaattagccaaa
gcgattacagaacggcgcaccgtcagggcgccttatcagccaacgcaggtgaatccaata
cagcaggcatgcctacagactttattcgacggctccccggtcacccttcatttctaccag
ggtgagccggtgcgccatgccgtcgcccaccttaccactcgatatgcgtctcttgatttc
tctcatcatcaggcttggcaagaaacctatcagttcattcggtttaatgaacgtcagtac
accgaggatggtttctatctgcataacctgtttggcccggtctccaacctgttcaagtgc
gttttccggatcgcctttcacccgaaactgaccccgctggccacgcgtttgcaattgccc
gccatgatggcgaaagggttggcaaaacaggtgggcgaagggccgcaatacctggcaatg
agcctgcaggatgaaagtgacgaacacctgtttatcgccggcatgacgctgggtcagctg
tggctgactttacactcatggggatggggcctgcatccgatcagcgtgctggtgcaacac
gccagtgcacggcatgccctgtccgatacgctggcgctggtcaacccagccgtttttttc
gcacgctttggtcatttgcaacaatctggcgcagccactcccaggcgcagttggcaaagt
attttaaccgtatcacatcaacattcggccgctgaaaccaaggccgatgtcagcaaattt
taa

DBGET integrated database retrieval system