KEGG   Serratia plymuthica AS9: SerAS9_1749
Entry
SerAS9_1749       CDS       T01503                                 
Name
(GenBank) Acetylornithine transaminase
  KO
K21778  3-acetyloctanal aminotransferase [EC:2.6.1.-]
Organism
srr  Serratia plymuthica AS9
Pathway
srr00333  Prodigiosin biosynthesis
srr01100  Metabolic pathways
srr01110  Biosynthesis of secondary metabolites
Module
srr_M00837  Prodigiosin biosynthesis, L-proline => prodigiosin
Brite
KEGG Orthology (KO) [BR:srr00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    SerAS9_1749
Enzymes [BR:srr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-
     SerAS9_1749
SSDB
Motif
Pfam: Aminotran_3 DUF5587
Other DBs
NCBI-ProteinID: AEF44879
LinkDB
Position
complement(1898397..1900958)
AA seq 853 aa
MKFGFIAHPTSVGLKRYVKMLDLLQRNSTEQHSGYKRDLWVRENLVPFMNFARITSATGA
TCEGVIKYMPLVADEMLADARGIANRVVQGIEELAGEGAELVGLGGFTSIVGRRGEATAE
KSPVPVTSGNSLTTYAGYKAMMQIQSWLDIKPDQEPVAIVGYPGSICLALSRLLLAQGFS
LHLLHRAGNHDREELLSHLPDQYHAQVTLTSDPNDLYPRCKLFAAATSAGGVIDPYKLQP
GSIFIDVALPRDIKADTRPNRDDILIIDGGCVTATDAVKLGGESLNVTIKQQMNGCMAET
IVLSLENRRENFSLGRYLPPEKVLEIGEIAERHGFMAYPLASYGERIDRQSVINLKRYYH
QDIYAGESDVAKQSETRLAFIDAIIAQDPAREDSLDRYRQFINPMMVDFLKLQHCDNVFR
RAAGTQLYTTDGEAFLDMVAGYGCLNLGHNPQPVIDALKTYLDAQGPNFIQYISIPEQTA
KLAEVLCQLSPGNMGRVFFSNSGTEAVEAAMKIAKASTGKPGIAYLKNSYHGKTLGALSI
TGRDKHRRYFTPLLDSMVEVPFGDIEALRQVLNRDDIGAVMIEPIQGEGGVHIPPDGYLQ
AVQQICRQTDTLLMVDEVQTGLGRTGKLFACEWDNIEPDVLMLSKSLCGGLLPIGATLCR
ADIWQKAYGTADRFLVHSSTFGGGNVASVVALSALREILAQDLVGQSERLGAYFKQALTD
VAARYPFVAEIRGRGLMLGIQFDQTFAGAVSASAREFATRLPGDWHTTWKFLPDPVQAHL
KAAMDRMEQSLGEMFCMKFVTKLCQDHKILTFITANSSTVIRIQPPLTINKAEIDRFVSA
FATVCDELSTFLE
NT seq 2562 nt   +upstreamnt  +downstreamnt
atgaagtttggatttatcgctcatccgacctcggttggtttaaaacgttacgtcaaaatg
ctcgacctgctgcagcgtaattcgactgagcaacatagcggttacaaacgcgacctttgg
gtccgcgaaaacctggtgccatttatgaactttgccagaatcacctcggctaccggcgcc
acctgcgaaggggtgatcaaatatatgccgctggtcgccgatgaaatgctggccgatgcc
cgtggcatcgccaatcgggtagtgcaaggtattgaagagttggccggagaaggagcagaa
ctggttggtttgggcgggtttacttccattgtgggtcgacgtggcgaagccactgccgaa
aaatccccggttcctgtcacctccggcaattcattgaccacctatgccggttacaaggcc
atgatgcaaattcaatcctggctggatattaaaccggatcaggaaccggtggcgattgtc
ggctatccgggttctatctgcctggcactgagtcgattattgcttgcgcaggggttctcc
cttcatttgctgcaccgcgccggtaaccatgaccgggaagaattactcagccatctgccc
gaccagtatcacgcgcaagtgaccctgaccagcgaccctaatgacttatacccacgttgc
aaactctttgccgcggcaacttctgcggggggcgtgatcgacccgtataaattgcagcct
ggatctatttttatcgacgtcgcgctgcccagagatatcaaggctgacacccgcccaaat
cgggatgacattctgattatcgatggcggctgcgtcacggcaacggatgcggtcaagctg
ggaggtgagtcgctgaatgtgactatcaaacagcagatgaatggctgtatggcggaaacc
atagtgttgtctttggagaaccgccgggaaaacttctcgctgggccgttatctgccgccg
gagaaggtgctggagatcggtgaaattgccgagcgccacggtttcatggcttatcctctg
gcctcatatggcgagcggattgatcgccagagcgtcattaacctcaagcgttactaccac
caggatatctatgccggcgagtcggacgttgccaaacagagcgagacgcgtctggccttt
atcgacgctattatcgcgcaagatcccgctcgggaggacagtctcgaccgttatcgccag
tttattaacccgatgatggtggatttcctcaaactgcagcattgcgacaatgtattccgc
cgcgctgcgggcacccagctctacaccaccgacggcgaggcttttctggatatggtggcc
ggctatggttgcctcaatctcggtcataacccgcagccggtgatcgatgcattgaaaacc
tatctcgatgctcaaggtcccaactttattcaatacatttcaattcccgaacaaaccgcc
aagcttgccgaagtactctgccagctgtcgccaggcaatatgggccgggttttcttcagc
aattcaggcaccgaggcggtagaagccgccatgaagatcgccaaagcctcgaccggtaaa
ccgggtatcgcctacctgaagaacagctaccacggcaagacactgggcgccctgtccatc
accggtcgcgacaaacaccgccgctattttaccccgctgctggactcgatggttgaagtg
ccgtttggcgatatagaagcattgcgtcaggtgctgaaccgcgacgatatcggtgccgtg
atgatcgaacctattcagggggaaggcggcgttcatatcccgccggacggttacctgcaa
gcggttcagcagatttgtcgccagactgacaccttactgatggtcgacgaagtgcaaacc
gggctgggacgcaccgggaaactctttgcttgtgaatgggataacatcgagccagacgtt
ctgatgctgtcaaaatcgctgtgcggtgggcttctccccattggcgccaccctgtgccgg
gccgatatttggcagaaagcctatggcacagcagaccgcttcctggtgcacagctcgacc
tttggcggtggcaacgtcgcttcagtggtggcgcttagcgccttgcgggagatcctggcc
caggatctggtcgggcaatccgaacggctgggtgcctattttaaacaggcgctgaccgac
gtcgccgcacgctatcccttcgtcgcagaaattcgcgggcgcggtctgatgctggggatc
cagttcgatcaaacctttgccggagcggtcagtgcttctgcccgcgagtttgccacccgc
ctgcccggagactggcacaccacctggaaattcctgcccgacccagtgcaggcccacttg
aaagcggccatggatcgcatggagcagtcgctgggtgaaatgttctgcatgaagtttgtc
accaagctctgtcaggaccacaagatcctgacgtttataaccgccaacagctcgacggtg
atccgcattcaacccccactcaccattaacaaagcagagatcgatcgtttcgtcagcgca
ttcgccacggtgtgcgatgaactatccacctttttagaatag

DBGET integrated database retrieval system