Serratia plymuthica AS9: SerAS9_1852 Help Entry SerAS9_1852       CDS       T01503                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism srr  Serratia plymuthica AS9 Pathway srr01100   Metabolic pathways srr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:srr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SerAS9_1852    00074 Mycolic acid biosynthesis     SerAS9_1852   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SerAS9_1852 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Motif Other DBs NCBI-ProteinID:  AEF44981 LinkDB All DBs Position 2006799..2007035 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIIVEQLGVKQEEVLNNASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDFINASQQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaatcattgttgagcaactgggtgttaaacag gaagaagttttaaataacgcttctttcgttgaagatctgggcgctgattctcttgacacc gttgaactggtaatggcactggaagaagaattcgataccgagattccagacgaagaagct gagaagatcactactgttcaggcagctattgatttcatcaacgctagccagcagtaa

DBGET integrated database retrieval system