Serratia plymuthica AS9: SerAS9_3351 Help Entry SerAS9_3351       CDS       T01503                                  Name (GenBank) DNA polymerase II beta subunit   KO K02345   DNA polymerase III subunit theta [EC:2.7.7.7] Organism srr  Serratia plymuthica AS9 Pathway srr03030   DNA replication srr03430   Mismatch repair srr03440   Homologous recombination Brite KEGG Orthology (KO) [BR:srr00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     SerAS9_3351    03430 Mismatch repair     SerAS9_3351    03440 Homologous recombination     SerAS9_3351  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:srr03032]     SerAS9_3351    03400 DNA repair and recombination proteins [BR:srr03400]     SerAS9_3351 Enzymes [BR:srr01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      SerAS9_3351 DNA replication proteins [BR:srr03032]  Prokaryotic type   DNA Replication Elongation Factors    Elongation factors (bacterial)     DNA polymerase III holoenzyme      SerAS9_3351 DNA repair and recombination proteins [BR:srr03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA polymerase III holoenzyme      SerAS9_3351 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol3_theta Motif Other DBs NCBI-ProteinID:  AEF46461 LinkDB All DBs Position 3571920..3572108 Genome browser AA seq 62 aa AA seqDB search MGRKLDSLPQAERERIEADLLALSVIYNERYGIASNAISAEEQVPDHLRPYFHQRLNYYR NA NT seq 189 nt NT seq  +upstreamnt  +downstreamnt atgggtcgaaagctggatagcttaccgcaggcagaacgtgaaagaattgaagccgattta ctcgcacttagcgtcatttataacgagcgttatggcattgcttccaacgccatcagcgct gaagaacaagtccccgaccacttacgcccctactttcatcagcgcctgaactactaccgc aatgcgtaa

DBGET integrated database retrieval system