Serratia sp. AS12: SerAS12_0814 Help Entry SerAS12_0814      CDS       T01502                                  Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism srs  Serratia sp. AS12 Pathway srs01100   Metabolic pathways srs01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:srs00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SerAS12_0814    00074 Mycolic acid biosynthesis     SerAS12_0814   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SerAS12_0814 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AEF48918 LinkDB All DBs Position 915322..915582 Genome browser AA seq 86 aa AA seqDB search MNLLSTEIKQLIIDTLNLEGMTPEEIDAEAPLFGEGLGLDSIDALELGLALKNRYGVVLS AESEDMRQHFYSVETLVKFVSALRSK NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgaatttattgagcaccgaaatcaagcaattgatcattgatacgctcaatcttgaaggt atgacgccggaggagattgatgccgaagcaccgctgtttggcgagggactgggcctggat tcgattgatgcgttggaattgggcctggcattaaagaaccgttatggcgtggtgctgtca gctgaaagcgaagacatgcgccaacatttttattccgtggaaacgctggtgaagtttgtt tctgcactgcgtagcaaataa

DBGET integrated database retrieval system