Serratia sp. AS12: SerAS12_3352 Help Entry SerAS12_3352      CDS       T01502                                  Name (GenBank) DNA polymerase II beta subunit   KO K02345   DNA polymerase III subunit theta [EC:2.7.7.7] Organism srs  Serratia sp. AS12 Pathway srs03030   DNA replication srs03430   Mismatch repair srs03440   Homologous recombination Brite KEGG Orthology (KO) [BR:srs00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     SerAS12_3352    03430 Mismatch repair     SerAS12_3352    03440 Homologous recombination     SerAS12_3352  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:srs03032]     SerAS12_3352    03400 DNA repair and recombination proteins [BR:srs03400]     SerAS12_3352 Enzymes [BR:srs01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      SerAS12_3352 DNA replication proteins [BR:srs03032]  Prokaryotic type   DNA Replication Elongation Factors    Elongation factors (bacterial)     DNA polymerase III holoenzyme      SerAS12_3352 DNA repair and recombination proteins [BR:srs03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA polymerase III holoenzyme      SerAS12_3352 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol3_theta Motif Other DBs NCBI-ProteinID:  AEF51413 LinkDB All DBs Position 3572048..3572236 Genome browser AA seq 62 aa AA seqDB search MGRKLDSLPQAERERIEADLLALSVIYNERYGIASNAISAEEQVPDHLRPYFHQRLNYYR NA NT seq 189 nt NT seq  +upstreamnt  +downstreamnt atgggtcgaaagctggatagcttaccgcaggcagaacgtgaaagaattgaagccgattta ctcgcacttagcgtcatttataacgagcgttatggcattgcttccaacgccatcagcgct gaagaacaagtccccgaccacttacgcccctactttcatcagcgcctgaactactaccgc aatgcgtaa

DBGET integrated database retrieval system