Salinibacter ruber DSM 13855: SRU_2809 Help Entry SRU_2809          CDS       T00312                                  Name (GenBank) conserved hypothetical protein   KO K09888   cell division protein ZapA Organism sru  Salinibacter ruber DSM 13855 Brite KEGG Orthology (KO) [BR:sru00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sru03036]     SRU_2809 Chromosome and associated proteins [BR:sru03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     SRU_2809 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapA DUF4404 DUF3470 TetR_C_15 DUF1690 MHB DUF6779 Dicty_REP Motif Other DBs NCBI-ProteinID:  ABC46068 UniProt:  Q2RYT1 LinkDB All DBs Position 3467181..3467480 Genome browser AA seq 99 aa AA seqDB search MREDDEAHTRRIASSVDARMRQFKDNHPDQAELTTAVMTALTLAEELYLQREEHEDGTTA LNEELARLSKQLEEATPAPDDAPDADAQAAGDSPDGPTP NT seq 300 nt NT seq  +upstreamnt  +downstreamnt gtgcgggaggacgacgaggcccacacccggcgcatcgcgtcctccgtggacgcccggatg aggcaatttaaggacaaccaccccgaccaggccgagctgacgaccgcggtcatgaccgcc ctcaccctcgccgaggagctgtatcttcagcgcgaggagcacgaggacggcaccacggcc ctcaacgaggagctggcccgcctgtcgaagcagctggaggaggcaacccccgcgcccgac gacgccccggacgcggacgcgcaggccgccggcgattcccccgacggaccaaccccctga

DBGET integrated database retrieval system