Salinigranum rubrum: C2R22_01610 Help Entry C2R22_01610       CDS       T05289                                  Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism srub  Salinigranum rubrum Pathway srub03010   Ribosome Brite KEGG Orthology (KO) [BR:srub00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     C2R22_01610   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     C2R22_01610  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:srub03011]     C2R22_01610    04121 Ubiquitin system [BR:srub04121]     C2R22_01610 Ribosome [BR:srub03011]  Ribosomal proteins   Eukaryotes    Large subunit     C2R22_01610   Archaea     C2R22_01610 Ubiquitin system [BR:srub04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    C2R22_01610 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_L40e Zn_Ribbon_1 DZR zf-CHY DZR_2 Cas12f1-like_TNB DHHC HVO_0416 Zn_ribbon_3 Zn_ribbon_RPAB4 Zn_ribbon_ZPR1 DUF6395 Ribosomal_L37e Motif Other DBs NCBI-ProteinID:  AUV80513 UniProt:  A0A2I8VF05 LinkDB All DBs Position complement(336916..337065) Genome browser AA seq 49 aa AA seqDB search MASFDAAEKRTLSKQICMRCNARNPQRATSCRKCGYKNLRPKSKERRAA NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggcgagtttcgacgctgccgaaaaacggacgctgagcaaacagatctgcatgcgctgt aacgcgcggaacccccagcgggccacgagttgccgcaagtgcggatacaagaacctccgt ccgaagtcgaaagagcgacgggcggcctga

DBGET integrated database retrieval system