Sinocyclocheilus rhinocerous: 107706908 Help Entry 107706908         CDS       T04916                                  Name (RefSeq) histone H2B.1, sperm-like   KO K11252   histone H2B Organism srx  Sinocyclocheilus rhinocerous Brite KEGG Orthology (KO) [BR:srx00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:srx03036]     107706908   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:srx04147]     107706908 Chromosome and associated proteins [BR:srx03036]  Eukaryotic type   Nucleosome assembly factors    Histones     107706908 Exosome [BR:srx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107706908 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone Motif Other DBs NCBI-GeneID:  107706908 NCBI-ProteinID:  XP_016366245 LinkDB All DBs Position Unknown AA seq 98 aa AA seqDB search MKTSSDRSQKSLKTSRRTGWTRKQSTKAYSAYIYKIEKELSDVADAVSVMRHLSDAHAQM GAEAARLSKFNRRRVITQRELHIAAKKLLTAEIEMLRF NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgaaaacctcgtctgacaggagccagaagtccctgaagacgtccaggagaaccggctgg acgcgcaaacagagcaccaaggcatattcagcttacatttacaagatcgagaaggagctg agtgacgtggctgacgccgtctctgtgatgcggcacctgtctgacgcgcatgcgcagatg ggcgcagaagccgcgcgactctccaagttcaaccggcggcgcgtcatcacgcagcgagag ctccacatcgctgcaaaaaagctcctgacagctgagattgaaatgctgcgcttttag

DBGET integrated database retrieval system