Sinocyclocheilus rhinocerous: 107707549 Help Entry 107707549         CDS       T04916                                  Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism srx  Sinocyclocheilus rhinocerous Pathway srx04010   MAPK signaling pathway srx04012   ErbB signaling pathway srx04068   FoxO signaling pathway srx04137   Mitophagy - animal srx04140   Autophagy - animal srx04144   Endocytosis srx04150   mTOR signaling pathway srx04210   Apoptosis srx04218   Cellular senescence srx04370   VEGF signaling pathway srx04371   Apelin signaling pathway srx04510   Focal adhesion srx04540   Gap junction srx04625   C-type lectin receptor signaling pathway srx04810   Regulation of actin cytoskeleton srx04910   Insulin signaling pathway srx04912   GnRH signaling pathway srx04916   Melanogenesis srx05132   Salmonella infection Brite KEGG Orthology (KO) [BR:srx00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     107707549    04012 ErbB signaling pathway     107707549    04370 VEGF signaling pathway     107707549    04371 Apelin signaling pathway     107707549    04068 FoxO signaling pathway     107707549    04150 mTOR signaling pathway     107707549  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     107707549    04140 Autophagy - animal     107707549    04137 Mitophagy - animal     107707549   09143 Cell growth and death    04210 Apoptosis     107707549    04218 Cellular senescence     107707549   09144 Cellular community - eukaryotes    04510 Focal adhesion     107707549    04540 Gap junction     107707549   09142 Cell motility    04810 Regulation of actin cytoskeleton     107707549  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     107707549   09152 Endocrine system    04910 Insulin signaling pathway     107707549    04912 GnRH signaling pathway     107707549    04916 Melanogenesis     107707549  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     107707549  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:srx04131]     107707549   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:srx04147]     107707549    04031 GTP-binding proteins [BR:srx04031]     107707549 Membrane trafficking [BR:srx04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     107707549  Endocytosis   Macropinocytosis    Ras GTPases     107707549 Exosome [BR:srx04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    107707549   Exosomal proteins of colorectal cancer cells    107707549 GTP-binding proteins [BR:srx04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     107707549 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin Ldh_1_N CbiA Motif Other DBs NCBI-GeneID:  107707549 NCBI-ProteinID:  XP_016367100 UniProt:  A0A673N1N7 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAQELARSYGIPFIETSAKTRQGVEDAFYTLVREIRQHKMRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgaatataagctggtggtggtgggcgctggaggcgtgggcaagagcgctctcacc atccaactcatccagaaccactttgtggatgaatacgaccccactatagaggactcctac aggaagcaggtggtgattgacggggagacatgtctcctggacatcttggacactgcaggt caggaggagtacagcgccatgagggaccagtacatgaggacaggagagggcttcctctgt gtgtttgccatcaataacaccaagtcctttgaggacattcatcagtacagggaacagatc aaacgggtgaaggactcggatgacgtgcccatggtgctggtgggtaacaagtgcgacctc ccggcccggacggtggacacacggcaagcacaggagctcgcgcgcagctacgggatcccc ttcatcgaaacctcagccaaaacacgacagggtgtggaggacgcgttttacacgctggtg cgagagatccgtcagcacaagatgaggaagctgaaccctccggatgagagcggacaggac tgcatgagctgccgctgcgtcgtgtcgtga

DBGET integrated database retrieval system