Sinocyclocheilus rhinocerous: 107710836 Help Entry 107710836         CDS       T04916                                  Name (RefSeq) ras-related protein Rab-7a-like   KO K07897   Ras-related protein Rab-7A Organism srx  Sinocyclocheilus rhinocerous Pathway srx04137   Mitophagy - animal srx04140   Autophagy - animal srx04144   Endocytosis srx04145   Phagosome srx04148   Efferocytosis srx05132   Salmonella infection Brite KEGG Orthology (KO) [BR:srx00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     107710836    04145 Phagosome     107710836    04140 Autophagy - animal     107710836    04137 Mitophagy - animal     107710836    04148 Efferocytosis     107710836  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     107710836  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:srx04131]     107710836   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:srx04147]     107710836    04031 GTP-binding proteins [BR:srx04031]     107710836 Membrane trafficking [BR:srx04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     107710836 Exosome [BR:srx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107710836   Exosomal proteins of other body fluids (saliva and urine)    107710836   Exosomal proteins of colorectal cancer cells    107710836   Exosomal proteins of bladder cancer cells    107710836 GTP-binding proteins [BR:srx04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     107710836 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  107710836 NCBI-ProteinID:  XP_016371174 LinkDB All DBs Position Unknown AA seq 144 aa AA seqDB search MIWDTAGQERFQSLGVAFYRGADCCVLVYDVTAPTTFKTMDSWRDEFLIQASPRDPENFP FVVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVDQAFQTIARNALKQESV ETYDFPDQIKLTDRPVSSSDGCSC NT seq 435 nt NT seq  +upstreamnt  +downstreamnt atgatttgggacacggcgggtcaggagcgctttcagtctctgggcgtggcgttctacaga ggggcggactgctgcgtgctggtttacgacgtcacggcaccaactacattcaagactatg gacagctggagggacgagtttctcattcaggccagtcctcgtgacccggagaacttcccc tttgttgtgctgggcaacaaaatcgacctggagaaccggcaggtgacgacaaagcgagct caagcgtggtgtcagagtaagaacaacatcccctattttgagaccagtgccaaagaagcc attaacgtggaccaggccttccaaactatcgctcgcaatgcactcaaacaggagtcggtg gagacgtatgacttccctgaccagattaaactaacagacagacctgtgtctagcagtgat ggctgcagctgctga

DBGET integrated database retrieval system