Sinocyclocheilus rhinocerous: 107721007 Help Entry 107721007         CDS       T04916                                  Symbol dynlt1 Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism srx  Sinocyclocheilus rhinocerous Pathway srx04814   Motor proteins srx05132   Salmonella infection Brite KEGG Orthology (KO) [BR:srx00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     107721007 (dynlt1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     107721007 (dynlt1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:srx03037]     107721007 (dynlt1)    04812 Cytoskeleton proteins [BR:srx04812]     107721007 (dynlt1) Cilium and associated proteins [BR:srx03037]  Motile cilia and associated proteins   Dynein arm    107721007 (dynlt1) Cytoskeleton proteins [BR:srx04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      107721007 (dynlt1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  107721007 NCBI-ProteinID:  XP_016384347 UniProt:  A0A673KIA0 LinkDB All DBs Position Unknown AA seq 113 aa AA seqDB search MDEDQSAEETTFVVEEITTVIKEAVESTIGNSSYQHSKINQWMSSIVESSLSQLTKLGKP FKYIVTCIILQKNGAGLHTASSCFWDNSTDGSCTVRWENKTIYCIVSVFGLAI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggacgaggatcagtctgctgaggagactacatttgttgtggaagagattaccacagtt atcaaagaagctgttgaaagcaccattggaaacagctcttaccagcacagtaaaatcaac cagtggatgtcaagcattgtagagtcaagtctaagccagctaactaaattaggaaagcct ttcaagtacatagtgacatgcatcatactccaaaaaaatggggcaggtttgcacactgcc agctcatgtttctgggacaacagtacagatgggagttgcacggtacgatgggagaataaa accatatactgcattgttagtgttttcgggcttgccatttga

DBGET integrated database retrieval system