Sinocyclocheilus rhinocerous: 107725308 Help Entry 107725308         CDS       T04916                                  Name (RefSeq) GTPase NRas-like   KO K07828   GTPase NRas Organism srx  Sinocyclocheilus rhinocerous Pathway srx04010   MAPK signaling pathway srx04012   ErbB signaling pathway srx04068   FoxO signaling pathway srx04137   Mitophagy - animal srx04140   Autophagy - animal srx04150   mTOR signaling pathway srx04210   Apoptosis srx04218   Cellular senescence srx04370   VEGF signaling pathway srx04371   Apelin signaling pathway srx04540   Gap junction srx04625   C-type lectin receptor signaling pathway srx04810   Regulation of actin cytoskeleton srx04910   Insulin signaling pathway srx04912   GnRH signaling pathway srx04916   Melanogenesis Brite KEGG Orthology (KO) [BR:srx00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     107725308    04012 ErbB signaling pathway     107725308    04370 VEGF signaling pathway     107725308    04371 Apelin signaling pathway     107725308    04068 FoxO signaling pathway     107725308    04150 mTOR signaling pathway     107725308  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     107725308    04137 Mitophagy - animal     107725308   09143 Cell growth and death    04210 Apoptosis     107725308    04218 Cellular senescence     107725308   09144 Cellular community - eukaryotes    04540 Gap junction     107725308   09142 Cell motility    04810 Regulation of actin cytoskeleton     107725308  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     107725308   09152 Endocrine system    04910 Insulin signaling pathway     107725308    04912 GnRH signaling pathway     107725308    04916 Melanogenesis     107725308  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:srx04131]     107725308   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:srx04147]     107725308    04031 GTP-binding proteins [BR:srx04031]     107725308 Membrane trafficking [BR:srx04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     107725308  Endocytosis   Macropinocytosis    Ras GTPases     107725308 Exosome [BR:srx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107725308   Exosomal proteins of other body fluids (saliva and urine)    107725308   Exosomal proteins of breast cancer cells    107725308   Exosomal proteins of colorectal cancer cells    107725308 GTP-binding proteins [BR:srx04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     107725308 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N ATP_bind_1 Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  107725308 NCBI-ProteinID:  XP_016390011 UniProt:  A0A673L8Q3 LinkDB All DBs Position Unknown AA seq 188 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNLKSFADVHLYREQIKRVKDSDDVPMVLVGNKCDL ARTVDTKQAQELARSYGIEFVETSAKTRQGVEDAFYTLVREIRHYRMKKLDSGEDGKQGC LGVSCEVM NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atgacggagtataagttggttgttgtgggagcaggtggtgttgggaagagtgctttaacc atccagctcattcaaaatcactttgtggatgaatatgaccctactattgaggactcttac aggaagcaggtggtgattgacggtgagacgtgtctgctggacatcctggacactgcaggg caggaagagtacagcgcaatgagggaccagtacatgaggacaggagagggtttcctctgt gtctttgccataaacaacctcaaatccttcgccgatgtgcatttgtacagagaacagatc aagcgcgtgaaggactccgatgatgttcccatggtcctagtggggaacaagtgtgatttg gccagaacggtggacaccaagcaagctcaggaacttgccagaagctacggcattgagttt gtagaaacttctgccaagaccagacagggagttgaggatgctttttacaccctcgtccgt gagatccgacattatcgcatgaaaaagctggacagcggagaagatgggaagcagggctgt ctgggcgtgtcctgtgaagtcatgtga

DBGET integrated database retrieval system