Sinocyclocheilus rhinocerous: 107728368 Help Entry 107728368         CDS       T04916                                  Name (RefSeq) ras-related protein Rab-7a-like   KO K07897   Ras-related protein Rab-7A Organism srx  Sinocyclocheilus rhinocerous Pathway srx04137   Mitophagy - animal srx04140   Autophagy - animal srx04144   Endocytosis srx04145   Phagosome srx04148   Efferocytosis srx05132   Salmonella infection Brite KEGG Orthology (KO) [BR:srx00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     107728368    04145 Phagosome     107728368    04140 Autophagy - animal     107728368    04137 Mitophagy - animal     107728368    04148 Efferocytosis     107728368  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     107728368  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:srx04131]     107728368   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:srx04147]     107728368    04031 GTP-binding proteins [BR:srx04031]     107728368 Membrane trafficking [BR:srx04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     107728368 Exosome [BR:srx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107728368   Exosomal proteins of other body fluids (saliva and urine)    107728368   Exosomal proteins of colorectal cancer cells    107728368   Exosomal proteins of bladder cancer cells    107728368 GTP-binding proteins [BR:srx04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     107728368 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW PduV-EutP Septin nSTAND3 AAA_7 NTPase_1 AAA_16 AAA_22 AAA_24 G-alpha SRPRB ATPase_2 ABC_tran AAA_5 ATP-synt_ab AAA_14 NACHT Motif Other DBs NCBI-GeneID:  107728368 NCBI-ProteinID:  XP_016393993 UniProt:  A0A673GZY8 LinkDB All DBs Position Unknown AA seq 204 aa AA seqDB search MASPKKVLLKVIILGDSGVGKTSLMNQYVNNKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVYDVTAPTTFKTMDSWRDEFLIQSSPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQESVE TYDFPDQIKLRNDRPVSSSDGCNC NT seq 615 nt NT seq  +upstreamnt  +downstreamnt atggcctctcctaagaaggtgctgctcaaagtgatcatcctaggggattctggagttggg aagacctctttgatgaaccagtatgtgaataataagttcagtaatcagtataaggccact attggagccgacttcctgactaaggaggtgatggtggacgacagactggtcaccatgcag atttgggacacggcgggacaagagcgctttcagtctctgggcgtggctttctacagaggg gcggactgttgcgtgctggtgtacgacgtcacggcaccaactacattcaagactatggac agctggagggatgagtttctcattcagtccagtcctcgtgacccagagaacttccccttt gttgtgctgggcaacaaaatcgacctggagaaccggcaggtaacgacaaagcgagctcaa gcgtggtgtcagagtaagaacaacatcccctattttgagaccagtgccaaagaagccatt aacgtggagcaggccttccaaactatcgctcgcaatgcacttaaacaggagtcagtggag acgtatgatttccctgaccagattaaactaagaaacgacagaccggtgtctagcagtgat ggctgcaactgctga

DBGET integrated database retrieval system