Sinocyclocheilus rhinocerous: 107730741 Help Entry 107730741         CDS       T04916                                  Name (RefSeq) insulin-like   KO K04526   insulin Organism srx  Sinocyclocheilus rhinocerous Pathway srx04010   MAPK signaling pathway srx04068   FoxO signaling pathway srx04081   Hormone signaling srx04114   Oocyte meiosis srx04140   Autophagy - animal srx04150   mTOR signaling pathway srx04810   Regulation of actin cytoskeleton srx04910   Insulin signaling pathway srx04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:srx00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     107730741    04068 FoxO signaling pathway     107730741    04150 mTOR signaling pathway     107730741   09133 Signaling molecules and interaction    04081 Hormone signaling     107730741  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     107730741   09143 Cell growth and death    04114 Oocyte meiosis     107730741   09142 Cell motility    04810 Regulation of actin cytoskeleton     107730741  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     107730741    04914 Progesterone-mediated oocyte maturation     107730741  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:srx04052]     107730741 Cytokines and neuropeptides [BR:srx04052]  Neuropeptides   Unclassified    107730741 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  107730741 NCBI-ProteinID:  XP_016397135 LinkDB All DBs Position Unknown AA seq 114 aa AA seqDB search MHRSGLLLLSLCAGSLVTHSGAFGNRRLCGTQLVEALLLVCGDKGLFYQPGRRIREHSFR VKMRNSAPFLRQTGVAAQSAEIGTARSSVAKRGIVEQCCHFYCDYYDLENYCNT NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgcacagatctggattgctcctgttgtcgctgtgtgccggctctctggtgacccatagt ggtgcgttcgggaatcgaagactgtgcgggactcagctcgtggaagcgctgctgcttgtc tgtggtgacaagggtctcttctaccagcctggcaggcgtatcagagagcacagtttccgc gtaaagatgaggaacagcgcccccttcctgcggcagactggagtggctgctcagagtgca gagataggcactgccagaagcagtgttgcaaagagaggcattgtagagcagtgctgtcat ttctactgtgactattatgacctggagaattactgtaacacatag

DBGET integrated database retrieval system