Sinocyclocheilus rhinocerous: 107734802 Help Entry 107734802         CDS       T04916                                  Name (RefSeq) claudin-4-like   KO K06087   claudin Organism srx  Sinocyclocheilus rhinocerous Pathway srx03272   Virion - Hepatitis viruses srx04382   Cornified envelope formation srx04514   Cell adhesion molecule (CAM) interaction srx04530   Tight junction Brite KEGG Orthology (KO) [BR:srx00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     107734802  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     107734802  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     107734802  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     107734802  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:srx03037]     107734802    04147 Exosome [BR:srx04147]     107734802 Cilium and associated proteins [BR:srx03037]  Other cilia and associated proteins   Stereociliary proteins    107734802 Exosome [BR:srx04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    107734802   Exosomal proteins of colorectal cancer cells    107734802 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin DUF7319 Clc-like Motif Other DBs NCBI-GeneID:  107734802 NCBI-ProteinID:  XP_016402206 LinkDB All DBs Position Unknown AA seq 141 aa AA seqDB search ILGMILTVAGWLGGMVACCLPMWRVAAYIGQNIVITQIVWEGLWMSCVVQSTGQMHCRVY DSMLGLPNDLQAARALTVVSTLLGVVGMALAVAGAKCTNCTSDAANKPRIMLAAGVTFIT CGLQLLVAVCWTANGIILDFH NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atcctggggatgatcctgaccgtggccgggtggctcggcgggatggtggcctgctgtctg cccatgtggagagtggcggcgtacataggccagaacatcgtcatcacgcagatcgtgtgg gaaggtttgtggatgagctgcgtggtgcagagcacaggacagatgcactgccgcgtctac gactccatgctggggcttcccaacgacctgcaggctgcgcgcgctctgacagtcgtgagt acgctgctcggtgtggtaggcatggctctggctgtggctggggcgaagtgcaccaactgc acatcagatgcagctaacaagccgcgcattatgctggcagccggggtgacgtttataacg tgtgggctgcagctgctagtggccgtctgttggacagctaacggcatcatcctggatttc cac

DBGET integrated database retrieval system