Sinocyclocheilus rhinocerous: 107735346 Help Entry 107735346         CDS       T04916                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism srx  Sinocyclocheilus rhinocerous Pathway srx04020   Calcium signaling pathway srx04070   Phosphatidylinositol signaling system srx04114   Oocyte meiosis srx04218   Cellular senescence srx04261   Adrenergic signaling in cardiomyocytes srx04270   Vascular smooth muscle contraction srx04371   Apelin signaling pathway srx04625   C-type lectin receptor signaling pathway srx04744   Phototransduction srx04910   Insulin signaling pathway srx04912   GnRH signaling pathway srx04916   Melanogenesis Brite KEGG Orthology (KO) [BR:srx00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     107735346    04020 Calcium signaling pathway     107735346    04070 Phosphatidylinositol signaling system     107735346  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     107735346    04218 Cellular senescence     107735346  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     107735346   09152 Endocrine system    04910 Insulin signaling pathway     107735346    04912 GnRH signaling pathway     107735346    04916 Melanogenesis     107735346   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     107735346    04270 Vascular smooth muscle contraction     107735346   09157 Sensory system    04744 Phototransduction     107735346  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:srx01009]     107735346   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:srx04131]     107735346    03036 Chromosome and associated proteins [BR:srx03036]     107735346   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:srx04147]     107735346 Protein phosphatases and associated proteins [BR:srx01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      107735346 Membrane trafficking [BR:srx04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     107735346 Chromosome and associated proteins [BR:srx03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      107735346 Exosome [BR:srx04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    107735346 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_6 EF-hand_5 AIF-1 EF-hand_9 EH EFhand_Ca_insen EF_EFCAB10_C EF-hand_11 SPARC_Ca_bdg DUF1103 DUF5580_M Dockerin_1 FCaBP_EF-hand Poly_export SurA_N_3 SPEF2_C Motif Other DBs NCBI-GeneID:  107735346 NCBI-ProteinID:  XP_016402542 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search TEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAA ELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK NT seq 318 nt NT seq  +upstreamnt  +downstreamnt acagaggcagagcttcaggatatgatcaatgaagttgatgctgatggcaatggaacgatt gatttcccagagttccttacaatgatggccaggaagatgaaggacacggatagtgaggag gagatcagagaagcattcagagtttttgataaggatggaaacggctatatcagtgcagca gagttgcgtcatgtcatgacaaatctgggggagaagcttacagacgaggaagtggatgag atgatccgggaggcagatattgatggtgatggtcaggtcaactatgaagagtttgtccag atgatgacagcaaagtaa

DBGET integrated database retrieval system