Sinocyclocheilus rhinocerous: 107737908 Help Entry 107737908         CDS       T04916                                  Symbol atg12 Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism srx  Sinocyclocheilus rhinocerous Pathway srx04068   FoxO signaling pathway srx04136   Autophagy - other srx04140   Autophagy - animal srx04621   NOD-like receptor signaling pathway srx04622   RIG-I-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:srx00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     107737908 (atg12)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     107737908 (atg12)    04136 Autophagy - other     107737908 (atg12)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     107737908 (atg12)    04622 RIG-I-like receptor signaling pathway     107737908 (atg12)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:srx04131]     107737908 (atg12)    04121 Ubiquitin system [BR:srx04121]     107737908 (atg12)    03029 Mitochondrial biogenesis [BR:srx03029]     107737908 (atg12) Membrane trafficking [BR:srx04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     107737908 (atg12) Ubiquitin system [BR:srx04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    107737908 (atg12) Mitochondrial biogenesis [BR:srx03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     107737908 (atg12) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  107737908 NCBI-ProteinID:  XP_016405031 UniProt:  A0A673GDY3 LinkDB All DBs Position Unknown AA seq 120 aa AA seqDB search MSDNAESPTENQKDDPSIQHTATEHTGSSDEKKKIDVLLKAVGDAPIMKTKKWSVESGRT VQSLAQFISRFLKLDPSEQLFIYVNQSFAPSPDQEVGVLFECFGSDGKLVLHYCKSQAWG NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atgtctgacaacgcagaatctcctacagaaaatcaaaaagatgatccctcgatacaacac actgccactgaacacactggatcgtcggatgagaagaaaaagattgatgtgctgttgaag gcggtcggtgatgcgcccatcatgaagaccaaaaaatggtctgtggaaagcgggaggaca gtacagtcactcgctcagtttatctcacgctttctcaaactcgatcctagtgaacaactg ttcatttatgtcaatcagtcatttgctccatcaccagaccaggaagtgggtgtgcttttt gagtgttttggaagtgatggtaaactagttctccattactgcaagtcccaggcctgggga tga

DBGET integrated database retrieval system