Sinocyclocheilus rhinocerous: 107741675 Help Entry 107741675         CDS       T04916                                  Name (RefSeq) ras-related protein Rab-7a-like   KO K07897   Ras-related protein Rab-7A Organism srx  Sinocyclocheilus rhinocerous Pathway srx04137   Mitophagy - animal srx04140   Autophagy - animal srx04144   Endocytosis srx04145   Phagosome srx04148   Efferocytosis srx05132   Salmonella infection Brite KEGG Orthology (KO) [BR:srx00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     107741675    04145 Phagosome     107741675    04140 Autophagy - animal     107741675    04137 Mitophagy - animal     107741675    04148 Efferocytosis     107741675  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     107741675  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:srx04131]     107741675   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:srx04147]     107741675    04031 GTP-binding proteins [BR:srx04031]     107741675 Membrane trafficking [BR:srx04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     107741675 Exosome [BR:srx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107741675   Exosomal proteins of other body fluids (saliva and urine)    107741675   Exosomal proteins of colorectal cancer cells    107741675   Exosomal proteins of bladder cancer cells    107741675 GTP-binding proteins [BR:srx04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     107741675 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase cobW ATP_bind_1 PduV-EutP nSTAND3 Septin AAA_16 AAA_22 NTPase_1 AAA_7 AAA_24 G-alpha AAA_5 DUF5992 SRPRB ATPase_2 ABC_tran NB-ARC NACHT AAA_14 ATP-synt_ab Motif Other DBs NCBI-GeneID:  107741675 NCBI-ProteinID:  XP_016409937 UniProt:  A0A673MUC1 LinkDB All DBs Position Unknown AA seq 205 aa AA seqDB search MASRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVYDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKSNIPYFETSAKEAINVDQAFQTIARNALKQESEV ETYDFPDQIKLRDDRPVSSGDGCSC NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atggcttctcgtaaaaaggtgcttctgaaggtgatcattctcggagattctggagttggg aagacttctttgatgaatcaatatgtcaataagaagttcagcaatcagtataaagccacc atcggtgcagactttcttaccaaggaggtgatggtggatgacagactggtgacaatgcag atctgggacacggcaggacaggagcgtttccagtctttgggtgtggctttttaccgcgga gcagactgctgcgtgctggtgtatgacgtgaccgcaccgaacaccttcaaaaccctggac agctggagggacgagttcctcattcaggccagccctcgagacccggagaacttccccttt gtagtgctcggcaacaaaatcgacttggagaacagacaggtgacaacgaaacgagcccag gcgtggtgtcagagcaaaagcaatatcccgtactttgagaccagtgcaaaagaggccatc aacgtggaccaagctttccaaacgatcgctcgcaacgccctcaaacaggagtctgaggtg gagacgtacgacttcccggaccagattaaactgagagatgacagacccgtgtcctctggt gacggctgcagctgctga

DBGET integrated database retrieval system