Sinocyclocheilus rhinocerous: 107745179 Help Entry 107745179         CDS       T04916                                  Name (RefSeq) interleukin-8-like isoform X1   KO K10030   interleukin 8 Organism srx  Sinocyclocheilus rhinocerous Pathway srx04060   Cytokine-cytokine receptor interaction srx04218   Cellular senescence srx04620   Toll-like receptor signaling pathway srx04621   NOD-like receptor signaling pathway srx04622   RIG-I-like receptor signaling pathway srx05132   Salmonella infection Brite KEGG Orthology (KO) [BR:srx00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     107745179  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     107745179  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     107745179    04621 NOD-like receptor signaling pathway     107745179    04622 RIG-I-like receptor signaling pathway     107745179  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     107745179  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:srx04052]     107745179    00536 Glycosaminoglycan binding proteins [BR:srx00536]     107745179 Cytokines and neuropeptides [BR:srx04052]  Cytokines   Chemokines    107745179 Glycosaminoglycan binding proteins [BR:srx00536]  Heparan sulfate / Heparin   Chemokines    107745179 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Gp_UL130 CXCL16 Motif Other DBs NCBI-GeneID:  107745179 NCBI-ProteinID:  XP_016414518 LinkDB All DBs Position Unknown AA seq 88 aa AA seqDB search MKFIAAAFVFLTCMTLLFTTEVTSARLQLRCPCIKMYSGKPINPKLIQKVQMIPAGAQCK NVAIIATLKNGQTCLNPKDEWVKKIIKG NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgaaattcatcgcagcagcctttgtttttctgacatgcatgacactgctgttcacaaca gaagtcacctcagccagactacagctacgctgcccgtgtattaaaatgtattcgggaaaa ccaattaaccctaaactaatacagaaagtacaaatgattcctgctggagcacagtgcaaa aacgtggcaatcattgccactctgaaaaatgggcagacgtgcctcaatcccaaagatgaa tgggtgaaaaagatcatcaaaggataa

DBGET integrated database retrieval system