Sinocyclocheilus rhinocerous: 107745499 Help Entry 107745499         CDS       T04916                                  Name (RefSeq) histone H3-like   KO K11253   histone H3 Organism srx  Sinocyclocheilus rhinocerous Brite KEGG Orthology (KO) [BR:srx00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:srx03036]     107745499   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:srx04147]     107745499 Chromosome and associated proteins [BR:srx03036]  Eukaryotic type   Nucleosome assembly factors    Histones     107745499 Exosome [BR:srx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107745499 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C CENP-S CBFD_NFYB_HMF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  107745499 NCBI-ProteinID:  XP_016414873 LinkDB All DBs Position Unknown AA seq 82 aa AA seqDB search YQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIH AKRVTIMPKDIQLARRTRGARP NT seq 249 nt NT seq  +upstreamnt  +downstreamnt tatcagaagtccaccgagctgctgatccgcaaactgcctttccagcgtctggtgcgagaa atcgctcaggacttcaagacggatctgcgcttccagagctccgctgtcatggccctgcag gaggccagcgaggcttatttggtcggtctgtttgaggacaccaacctgtgcgccatccac gccaagagagtcaccatcatgcccaaagacatccagctggcccgccgcacccggggagcg cgcccttaa

DBGET integrated database retrieval system