Sinocyclocheilus rhinocerous: 107745963 Help Entry 107745963         CDS       T04916                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism srx  Sinocyclocheilus rhinocerous Pathway srx04060   Cytokine-cytokine receptor interaction srx04218   Cellular senescence srx04620   Toll-like receptor signaling pathway srx04621   NOD-like receptor signaling pathway srx04622   RIG-I-like receptor signaling pathway srx05132   Salmonella infection Brite KEGG Orthology (KO) [BR:srx00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     107745963  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     107745963  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     107745963    04621 NOD-like receptor signaling pathway     107745963    04622 RIG-I-like receptor signaling pathway     107745963  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     107745963  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:srx04052]     107745963    00536 Glycosaminoglycan binding proteins [BR:srx00536]     107745963 Cytokines and neuropeptides [BR:srx04052]  Cytokines   Chemokines    107745963 Glycosaminoglycan binding proteins [BR:srx00536]  Heparan sulfate / Heparin   Chemokines    107745963 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  107745963 NCBI-ProteinID:  XP_016415480 UniProt:  A0A673GXT7 LinkDB All DBs Position Unknown AA seq 99 aa AA seqDB search MKLTVSALVLLICTAALLSTTEGRPKRLQLRCSCPQMHSESAIPAVKILSLRVIPAGPHC KNEEIIATMKKGPMCLDPTKDWVISLKEEINKRNVTSQQ NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgaaactcacagtatcggctctcgtgcttctgatctgcacagctgcactgctgtccaca acagagggtagacctaaacgcctacagctacgctgcagctgccctcaaatgcattcagag tcagcaattcctgctgtaaaaatactctcattgagggttattcctgccggaccacattgc aaaaatgaggagatcattgccacaatgaagaaaggaccgatgtgtcttgatcctactaaa gactgggtgatttctctcaaagaagaaatcaacaagaggaacgtcacaagccaacaatga

DBGET integrated database retrieval system