Sinocyclocheilus rhinocerous: 107750796 Help Entry 107750796         CDS       T04916                                  Name (RefSeq) claudin-7-A-like   KO K06087   claudin Organism srx  Sinocyclocheilus rhinocerous Pathway srx03272   Virion - Hepatitis viruses srx04382   Cornified envelope formation srx04514   Cell adhesion molecules srx04530   Tight junction Brite KEGG Orthology (KO) [BR:srx00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     107750796  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     107750796  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     107750796  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     107750796  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:srx03037]     107750796    04147 Exosome [BR:srx04147]     107750796    04515 Cell adhesion molecules [BR:srx04515]     107750796 Cilium and associated proteins [BR:srx03037]  Other cilia and associated proteins   Stereociliary proteins    107750796 Exosome [BR:srx04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    107750796   Exosomal proteins of colorectal cancer cells    107750796 Cell adhesion molecules [BR:srx04515]  Immunoglobulin superfamily   L1 family    107750796 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 OppC_N DUF728 CPP1-like Motif Other DBs NCBI-GeneID:  107750796 NCBI-ProteinID:  XP_016421802 LinkDB All DBs Position Unknown AA seq 158 aa AA seqDB search MANSGVQLLGFGLSLIGIIGLIVGTILPQWKMSAYVGDSIITAVATYQGLWMSCAFQSTG QLQCKIYDSILQLDSDLQATRALMIVGIIVSICGLGVACMGMKCTTCGANDKVRKARTAM TGGIILLVGALCAIVACSWFAHNVIRAFYNPFTPVNTK NT seq 477 nt NT seq  +upstreamnt  +downstreamnt atggcaaactcgggcgttcagttgcttggatttggtctctctctgattggcatcattgga ctgatcgtgggcaccatcctgccgcagtggaagatgtccgcgtacgtgggggacagtatt atcacggcagtggccacttaccaaggactgtggatgtcctgcgcgtttcagagcaccgga cagcttcagtgcaaaatctacgactccattctacaattagacagtgatcttcaagcgacc cgtgctttgatgattgtgggtatcattgtgtccatttgcggtcttggtgtggcctgcatg ggcatgaagtgcaccacttgtggagctaatgacaaagttcgcaaggctcgcacggccatg acaggaggcatcatactgctagtgggagccctctgtgcaattgttgcctgttcgtggttt gcccacaatgtgattcgagctttctacaaccccttcactccagtcaacaccaagtga

DBGET integrated database retrieval system