Sinocyclocheilus rhinocerous: 107750810 Help Entry 107750810         CDS       T04916                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism srx  Sinocyclocheilus rhinocerous Pathway srx04382   Cornified envelope formation srx05132   Salmonella infection Brite KEGG Orthology (KO) [BR:srx00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     107750810  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     107750810  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:srx04147]     107750810 Exosome [BR:srx04147]  Exosomal proteins   Exosomal proteins of microglial cells    107750810 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 Motif Other DBs NCBI-GeneID:  107750810 NCBI-ProteinID:  XP_016421820 LinkDB All DBs Position Unknown AA seq 101 aa AA seqDB search MPSELETAMESLIMVFHRYAGKEGKNGTLTRRELRTLMENELSGFLKSQKDPTTIDRIMK DLDANGDGEVNFEEFVSLVVGLSIACEACYRMQLKKTQSWK NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgccatccgagctagagactgccatggagtccctcatcatggtattccaccgctacgct ggaaaagagggcaagaacggcaccctgacccgccgtgaactccgaaccctgatggagaac gagctctctgggtttctcaagtctcagaaggatccgaccaccatagacagaattatgaag gacttggatgccaatggagatggggaggtgaactttgaggagtttgtgtctttggttgtg ggtttgtccatcgcttgtgaggcgtgctatagaatgcagttaaagaagacacagagctgg aaatga

DBGET integrated database retrieval system