Sinocyclocheilus rhinocerous: 107753785 Help Entry 107753785         CDS       T04916                                  Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism srx  Sinocyclocheilus rhinocerous Pathway srx04137   Mitophagy - animal srx04140   Autophagy - animal srx04144   Endocytosis srx04145   Phagosome srx04148   Efferocytosis srx05132   Salmonella infection Brite KEGG Orthology (KO) [BR:srx00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     107753785    04145 Phagosome     107753785    04140 Autophagy - animal     107753785    04137 Mitophagy - animal     107753785    04148 Efferocytosis     107753785  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     107753785  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:srx04131]     107753785   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:srx04147]     107753785    04031 GTP-binding proteins [BR:srx04031]     107753785 Membrane trafficking [BR:srx04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     107753785 Exosome [BR:srx04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107753785   Exosomal proteins of other body fluids (saliva and urine)    107753785   Exosomal proteins of colorectal cancer cells    107753785   Exosomal proteins of bladder cancer cells    107753785 GTP-binding proteins [BR:srx04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     107753785 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_16 AAA_7 NTPase_1 AAA_22 AAA_24 G-alpha AAA_5 ATPase_2 NACHT NB-ARC AAA_14 SRPRB ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  107753785 NCBI-ProteinID:  XP_016425496 UniProt:  A0A673KFN8 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRNDRAKPSAETCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacatcaaggaagaaagttcttctgaaggtgatcattcttggagactctggggttggg aagacatctctgatgaaccagtatgtgaataagaagttcagtaatcagtacaaagctact ataggagcagatttcctgacaaaagaagtgatggttgatgaccgacttgtcacaatgcag atatgggacacagcaggtcaagagcggttccagtctctgggtgtggctttctaccgcggt gccgactgctgtgtgctggtgttcgacgtcactgccccaaacaccttcaagacactggac agctggagggacgagtttctcatccaggccagcccgcgcgacccagagaacttccccttt gtggtactgggcaacaaaatcgatctggagaataggcaggtaacaaccaagcgggcacag gcttggtgtcaaagtaagaacaacatcccgtattttgagaccagtgcaaaggaggccatc aacgtagagcaggctttccagaccatcgcgcgcaatgcactcaaacaggaaaccgaagtg gagttatacaacgagttccctgagccaattaaactagaccggaacgatagagccaagcca tcagcagagacttgcagctgctga

DBGET integrated database retrieval system