Sinocyclocheilus rhinocerous: 107754595 Help Entry 107754595         CDS       T04916                                  Name (RefSeq) C-C motif chemokine 25-like   KO K13072   C-C motif chemokine 25 Organism srx  Sinocyclocheilus rhinocerous Pathway srx04060   Cytokine-cytokine receptor interaction srx04672   Intestinal immune network for IgA production Brite KEGG Orthology (KO) [BR:srx00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     107754595  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     107754595  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:srx04052]     107754595 Cytokines and neuropeptides [BR:srx04052]  Cytokines   Chemokines    107754595 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  107754595 NCBI-ProteinID:  XP_016426585 UniProt:  A0A673LAW1 LinkDB All DBs Position Unknown AA seq 102 aa AA seqDB search MRFSILFFIVLLGFLYLTLAQGSYEDCCLQYVKNIKPSTRNRVISYRKLELDGGCNIPAV VFTMKRGRMICTDPREKWVHELMQRVDRLTRVSFMKRKNLRG NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgcggttcagcatcctcttcttcatcgtcctcctgggattcctctacctcacactggca caaggctcgtatgaggactgctgtctgcagtatgtcaaaaatattaaaccgtctacgagg aacagagtgatcagctacagaaaactagagctggacggaggctgcaacatcccagctgtt gtcttcacaatgaaacgtggccgtatgatttgcaccgaccccagagaaaaatgggtccat gaactcatgcagagggtggacagactaacaagggtctcatttatgaagaggaagaattta aggggttaa

DBGET integrated database retrieval system