Sinocyclocheilus rhinocerous: 107757516 Help Entry 107757516         CDS       T04916                                  Name (RefSeq) GTPase HRas-like   KO K02833   GTPase HRas Organism srx  Sinocyclocheilus rhinocerous Pathway srx04010   MAPK signaling pathway srx04012   ErbB signaling pathway srx04068   FoxO signaling pathway srx04137   Mitophagy - animal srx04140   Autophagy - animal srx04144   Endocytosis srx04150   mTOR signaling pathway srx04210   Apoptosis srx04218   Cellular senescence srx04370   VEGF signaling pathway srx04371   Apelin signaling pathway srx04510   Focal adhesion srx04519   Cadherin signaling srx04540   Gap junction srx04625   C-type lectin receptor signaling pathway srx04810   Regulation of actin cytoskeleton srx04910   Insulin signaling pathway srx04912   GnRH signaling pathway srx04916   Melanogenesis srx05132   Salmonella infection Brite KEGG Orthology (KO) [BR:srx00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     107757516    04012 ErbB signaling pathway     107757516    04370 VEGF signaling pathway     107757516    04371 Apelin signaling pathway     107757516    04068 FoxO signaling pathway     107757516    04150 mTOR signaling pathway     107757516   09133 Signaling molecules and interaction    04519 Cadherin signaling     107757516  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     107757516    04140 Autophagy - animal     107757516    04137 Mitophagy - animal     107757516   09143 Cell growth and death    04210 Apoptosis     107757516    04218 Cellular senescence     107757516   09144 Cellular community - eukaryotes    04510 Focal adhesion     107757516    04540 Gap junction     107757516   09142 Cell motility    04810 Regulation of actin cytoskeleton     107757516  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     107757516   09152 Endocrine system    04910 Insulin signaling pathway     107757516    04912 GnRH signaling pathway     107757516    04916 Melanogenesis     107757516  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     107757516  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:srx04131]     107757516   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:srx04147]     107757516    04031 GTP-binding proteins [BR:srx04031]     107757516 Membrane trafficking [BR:srx04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     107757516  Endocytosis   Macropinocytosis    Ras GTPases     107757516 Exosome [BR:srx04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    107757516   Exosomal proteins of colorectal cancer cells    107757516 GTP-binding proteins [BR:srx04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     107757516 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf RsgA_GTPase MMR_HSR1 FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  107757516 NCBI-ProteinID:  XP_016430493 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFLYIYIYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDDNGQG CMNCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggaatataagttagtggtggttggtgcaggtggtgtgggcaagagtgctctgaca atccagctcattcagaaccactttgttgatgaatacgacccaaccattgaggactcatat aggaaacaggtggtgattgatggagagacgtgtctgttggatatcctggatactgcaggt caggaagagtacagtgcaatgagagaccagtacatgaggaccggagagggctttctctgt gtctttgccatcaacaataccaagtcttttttatatatatatatatatagggaacagatt aagagggttaaagactcagatgatgtgcctatggtgcttgtgggtaataaatgtgactta ccagcgcgcactgtggacacaagacaagcccaggaactcgcccgtagctacggtataccc tacattgaaacctcagccaagacaagacagggagtggaagatgccttttacactcttgtc cgtgaaatcaggcagcataagctgaggaaactgaacccgccagatgacaatggtcaaggc tgtatgaactgccgctgtgtggtgtcatga

DBGET integrated database retrieval system