Serratia plymuthica S13: M621_01555 Help Entry M621_01555        CDS       T02716                                  Symbol hfq Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism sry  Serratia plymuthica S13 Pathway sry02024   Quorum sensing sry03018   RNA degradation Brite KEGG Orthology (KO) [BR:sry00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     M621_01555 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     M621_01555 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:sry03019]     M621_01555 (hfq)    03036 Chromosome and associated proteins [BR:sry03036]     M621_01555 (hfq) Messenger RNA biogenesis [BR:sry03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      M621_01555 (hfq) Chromosome and associated proteins [BR:sry03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     M621_01555 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  AGP42693 UniProt:  S4YIJ9 LinkDB All DBs Position 340070..340378 Genome browser AA seq 102 aa AA seqDB search MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPSRPVSHHSNNPSAGTSNYHHGNNPSAPQQPQQESDDAE NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctttgcaagatccgttcctgaacgcattgcgtcgtgaacgtgtt ccggtttctatttatttggtgaatggtattaagctgcaaggccagattgagtcttttgac cagtttgtcatcctgttgaaaaacacggtgagccagatggtttataagcacgctatctct accgttgttccgtcacgcccggtttcgcaccatagcaacaatccgagcgccggcaccagt aactatcaccatggtaacaacccgtctgcgccgcaacagccgcagcaggaaagcgatgac gctgaataa

DBGET integrated database retrieval system