Serratia plymuthica S13: M621_04130 Help Entry M621_04130        CDS       T02716                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sry  Serratia plymuthica S13 Pathway sry00998   Biosynthesis of various antibiotics sry01100   Metabolic pathways sry01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sry00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     M621_04130    00074 Mycolic acid biosynthesis     M621_04130   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     M621_04130 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AGP43103 UniProt:  S4YJV7 LinkDB All DBs Position 891289..891549 Genome browser AA seq 86 aa AA seqDB search MNLLSTEIKQLIIDTLNLEGMTPEEIDAEAPLFGDGLGLDSIDALELGLALKNRYGVVLS AESEDMRQHFYSVETLVKFVSALRSK NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgaatttattgagcaccgaaatcaagcaattgatcattgatacgctcaatcttgaaggt atgacgccggaggagattgacgccgaagcaccgctgtttggtgatggactgggcctggac tcgattgatgcgttggaattgggcctggcattaaagaaccgttatggcgtggtgctgtca gctgaaagcgaagacatgcgccaacatttttattccgtggaaacgctggtgaagtttgtt tctgcactgcgtagcaaataa

DBGET integrated database retrieval system